Mitofusin 2 (MFN2) (NM_014874) Human Recombinant Protein
CAT#: TP302218
Recombinant protein of human mitofusin 2 (MFN2), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg
View other "Mitofusin 2" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 5 publications. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202218 protein sequence
Red=Cloning site Green=Tags(s) MSLLFSRCNSIVTVKKNKRHMAEVNASPLKHFVTAKKKINGIFEQLGAYIQESATFLEDTYRNAELDPVT TEEQVLDVKGYLSKVRGISEVLARRHMKVAFFGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVEGTD GHEAFLLTEGSEEKRSAKTVNQLAHALHQDKQLHAGSLVSVMWPNSKCPLLKDDLVLMDSPGIDVTTELD SWIDKFCLDADVFVLVANSESTLMQTEKHFFHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHMER CTSFLVDELGVVDRSQAGDRIFFVSAKEVLNARIQKAQGMPEGGGALAEGFQVRMFEFQNFERRFEECIS QSAVKTKFEQHTVRAKQIAEAVRLIMDSLHMAAREQQVYCEEMREERQDRLKFIDKQLELLAQDYKLRIK QITEEVERQVSTAMAEEIRRLSVLVDDYQMDFHPSPVVLKVYKNELHRHIEEGLGRNMSDRCSTAITNSL QTMQQDMIDGLKPLLPVSVRSQIDMLVPRQCFSLNYDLNCDKLCADFQEDIEFHFSLGWTMLVNRFLGPK NSRRALMGYNDQVQRPIPLTPANPSMPPLPQGSLTQEEFMVSMVTGLASLTSRTSMGILVVGGVVWKAVG WRLIALSFGLYGLLYVYERLTWTTKAKERAFKRQFVEHASEKLQLVISYTGSNCSHQVQQELSGTFAHLC QQVDVTRENLEQEIAAMNKKIEVLDSLQSKAKLLRNKAGWLDSELNMFTHQYLQPSR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 86.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | WB positive control (PMID: 29791782) |
Reference Data | |
RefSeq | NP_055689 |
Locus ID | 9927 |
UniProt ID | O95140 |
Refseq Size | 4685 |
Cytogenetics | 1p36.22 |
Refseq ORF | 2271 |
Synonyms | CMT2A; CMT2A2; CMT2A2A; CMT2A2B; CPRP1; HMSN6A; HSG; MARF |
Summary | This gene encodes a mitochondrial membrane protein that participates in mitochondrial fusion and contributes to the maintenance and operation of the mitochondrial network. This protein is involved in the regulation of vascular smooth muscle cell proliferation, and it may play a role in the pathophysiology of obesity. Mutations in this gene cause Charcot-Marie-Tooth disease type 2A2, and hereditary motor and sensory neuropathy VI, which are both disorders of the peripheral nervous system. Defects in this gene have also been associated with early-onset stroke. Two transcript variants encoding the same protein have been identified. [provided by RefSeq, Jul 2008] |
Protein Families | Transmembrane |
Citations (5)
The use of this Proteins has been cited in the following citations: |
---|
Bile acids target mitofusin 2 to differentially regulate innate immunity in physiological versus cholestatic conditions.
,null,
Cell reports
,PubMed ID 36656708
[MFN2]
|
Obesity leads to impairments in the morphology and organization of human skeletal muscle lipid droplets and mitochondrial networks, which are resolved with gastric bypass surgery-induced improvements in insulin sensitivity
,Kristensen, MD;Petersen, SM;Møller, KE;Lund, MT;Hansen, M;Hansen, CN;Courraud, J;Helge, JW;Dela, F;Prats, C;,
Acta Physiol (Oxf) 2018
,PubMed ID 29791782
[MFN2]
|
Correcting mitochondrial fusion by manipulating mitofusin conformations
,null,
Nature
,PubMed ID 27775718
[MFN2]
|
MFN2 Couples Glutamate Excitotoxicity and Mitochondrial Dysfunction in Motor Neurons *MFN2 Couples Glutamate Excitotoxicity and Mitochondrial Dysfunction in Motor Neurons * ♦
,null,
The Journal of Biological Chemistry
,PubMed ID 25416777
[MFN2]
|
Conditional Knockout of Proximal Tubule Mitofusin 2 Accelerates Recovery and Improves Survival after Renal Ischemia
,null,
Journal of the American Society of Nephrology : JASN
,PubMed ID 25201884
[MFN2]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402384 | MFN2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426838 | MFN2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY402384 | Transient overexpression lysate of mitofusin 2 (MFN2), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 3,080.00 |
|
LY426838 | Transient overexpression lysate of mitofusin 2 (MFN2), transcript variant 2 |
CNY 4,840.00 |
|
PH302218 | MFN2 MS Standard C13 and N15-labeled recombinant protein (NP_055689) |
CNY 19,520.00 |
|
PH326143 | MFN2 MS Standard C13 and N15-labeled recombinant protein (NP_001121132) |
CNY 19,520.00 |
|
TP326143 | Recombinant protein of human mitofusin 2 (MFN2), transcript variant 2, 20 µg |
CNY 2,900.00 |
其它Mitofusin 2产品