MAGE 1 (MAGEA1) (NM_004988) Human Recombinant Protein
CAT#: TP302134
Purified recombinant protein of Homo sapiens melanoma antigen family A, 1 (directs expression of antigen MZ2-E) (MAGEA1), 20 µg
View other "MAGE 1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202134 protein sequence
Red=Cloning site Green=Tags(s) MSLEQRSLHCKPEEALEAQQEALGLVCVQAAASSSSPLVLGTLEEVPTAGSTDPPQSPQGASAFPTTINF TRQRQPSEGSSSREEEGPSTSCILESLFRAVITKKVADLVGFLLLKYRAREPVTKAEMLESVIKNYKHCF PEIFGKASESLQLVFGIDVKEADPTGHSYVLVTCLGLSYDGLLGDNQIMPKTGFLIIVLVMIAMEGGHAP EEEIWEELSVMEVYDGREHSAYGEPRKLLTQDLVQEKYLEYRQVPDSDPARYEFLWGPRALAETSYVKVL EYVIKVSARVRFFFPSLREAALREEEEGV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 34.2 kDa |
Concentration | >0.1 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004979 |
Locus ID | 4100 |
UniProt ID | P43355 |
Refseq Size | 1755 |
Cytogenetics | Xq28 |
Refseq ORF | 927 |
Synonyms | CT1.1; MAGE1 |
Summary | This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401552 | MAGEA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401552 | Transient overexpression lysate of melanoma antigen family A, 1 (directs expression of antigen MZ2-E) (MAGEA1) |
CNY 3,080.00 |
|
PH302134 | MAGEA1 MS Standard C13 and N15-labeled recombinant protein (NP_004979) |
CNY 14,250.00 |