G0S2 (NM_015714) Human Recombinant Protein
CAT#: TP302063L
Recombinant protein of human G0/G1switch 2 (G0S2), 1 mg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 36,000.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202063 protein sequence
Red=Cloning site Green=Tags(s) METVQELIPLAKEMMAQKRKGKMVKLYVLGSVLALFGVVLGLMETVCSPFTAARRLRDQEAAVAELQAAL ERQALQKQALQEKGKQQDTVLGGRALSNRQHAS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 11.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | Enzyme activity regulator (PMID: 27408777) |
Reference Data | |
RefSeq | NP_056529 |
Locus ID | 50486 |
UniProt ID | P27469 |
Refseq Size | 978 |
Cytogenetics | 1q32.2 |
Refseq ORF | 309 |
Summary | Promotes apoptosis by binding to BCL2, hence preventing the formation of protective BCL2-BAX heterodimers.[UniProtKB/Swiss-Prot Function] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |