PDCD6 (NM_013232) Human Recombinant Protein
CAT#: TP302030
Recombinant protein of human programmed cell death 6 (PDCD6), 20 µg
View other "PDCD6" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202030 protein sequence
Red=Cloning site Green=Tags(s) MAAYSYRPGPGAGPGPAAGAALPDQSFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVRSIIS MFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDR QGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFSIV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 21.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_037364 |
Locus ID | 10016 |
UniProt ID | O75340, Q53FC3 |
Refseq Size | 1151 |
Cytogenetics | 5p15.33 |
Refseq ORF | 573 |
Synonyms | ALG-2; ALG2; PEF1B |
Summary | This gene encodes a calcium-binding protein belonging to the penta-EF-hand protein family. Calcium binding is important for homodimerization and for conformational changes required for binding to other protein partners. This gene product participates in T cell receptor-, Fas-, and glucocorticoid-induced programmed cell death. In mice deficient for this gene product, however, apoptosis was not blocked suggesting this gene product is functionally redundant. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is also located on the short arm of chromosome 5. [provided by RefSeq, May 2012] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415726 | PDCD6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415726 | Transient overexpression lysate of programmed cell death 6 (PDCD6) |
CNY 3,080.00 |
|
PH302030 | PDCD6 MS Standard C13 and N15-labeled recombinant protein (NP_037364) |
CNY 19,520.00 |