GRO alpha (CXCL1) (NM_001511) Human Recombinant Protein
CAT#: TP301992
Purified recombinant protein of Human chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha) (CXCL1), full length, with C-terminal MYC/DDK tag,expressed in HEK293T cells, 20 ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201992 protein sequence
Red=Cloning site Green=Tags(s) MARAALSAAPSNPRLLRVALLLLLLVAAGRRAAGASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCA QTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 11.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate Bradford method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25mM Tris.HCl, pH7.3, 100mM glycine, 10% glycerol. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for at least 1 year from receipt of products under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001502 |
Locus ID | 2919 |
UniProt ID | P09341 |
Refseq Size | 1184 |
Cytogenetics | 4q13.3 |
Refseq ORF | 321 |
Synonyms | FSP; GRO1; GROa; MGSA; MGSA-a; NAP-3; SCYB1 |
Summary | This antimicrobial gene encodes a member of the CXC subfamily of chemokines. The encoded protein is a secreted growth factor that signals through the G-protein coupled receptor, CXC receptor 2. This protein plays a role in inflammation and as a chemoattractant for neutrophils. Aberrant expression of this protein is associated with the growth and progression of certain tumors. A naturally occurring processed form of this protein has increased chemotactic activity. Alternate splicing results in coding and non-coding variants of this gene. A pseudogene of this gene is found on chromosome 4. [provided by RefSeq, Sep 2014] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Chemokine signaling pathway, Cytokine-cytokine receptor interaction, Epithelial cell signaling in Helicobacter pylori infection, NOD-like receptor signaling pathway |
Documents
FAQs |
SDS |
其它GRO alpha产品