HDAC11 (NM_024827) Human Recombinant Protein
CAT#: TP301919
Recombinant protein of human histone deacetylase 11 (HDAC11), transcript variant 2, 20 µg
View other "HDAC11" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201919 protein sequence
Red=Cloning site Green=Tags(s) MLHTTQLYQHVPETRWPIVYSPRYNITFMGLEKLHPFDAGKWGKVINFLKEEKLLSDSMLVEAREASEED LLVVHTRRYLNELKWSFAVATITEIPPVIFLPNFLVQRKVLRPLRTQTGGTIMAGKLAVERGWAINVGGG FHHCSSDRGGGFCAYADITLAIKFLFERVEGISRATIIDLDAHQGNGHERDFMDDKRVYIMDVYNRHIYP GDRFAKQAIRRKVELEWGTEDDEYLDKVERNIKKSLQEHLPDVVVYNAGTDILEGDRLGGLSISPAGIVK RDELVFRMVRGRRVPILMVTSGGYQKRTARIIADSILNLFGLGLIGPESPSVSAQNSDTPLLPPAVP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 39 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_079103 |
Locus ID | 79885 |
UniProt ID | Q96DB2 |
Refseq Size | 2918 |
Cytogenetics | 3p25.1 |
Refseq ORF | 1041 |
Synonyms | HD11 |
Summary | This gene encodes a class IV histone deacetylase. The encoded protein is localized to the nucleus and may be involved in regulating the expression of interleukin 10. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Apr 2009] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403040 | HDAC11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427788 | HDAC11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403040 | Transient overexpression lysate of histone deacetylase 11 (HDAC11), transcript variant 1 |
CNY 3,080.00 |
|
LY427788 | Transient overexpression lysate of histone deacetylase 11 (HDAC11), transcript variant 2 |
CNY 3,080.00 |
|
PH301919 | HDAC11 MS Standard C13 and N15-labeled recombinant protein (NP_079103) |
CNY 19,520.00 |