Ephrin B1 (EFNB1) (NM_004429) Human Recombinant Protein
CAT#: TP301886
Recombinant protein of human ephrin-B1 (EFNB1), 20 µg
View other "Ephrin B1" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 3,280.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201886 protein sequence
Red=Cloning site Green=Tags(s) MARPGQRWLGKWLVAMVVWALCRLATPLAKNLEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAG RPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNRPEQEIRFTIKFQEFSPNYMGLEFKKHHDYYITSTSNG SLEGLENREGGVCRTRTMKIIMKVGQDPNAVTPEQLTTSRPSKEADNTVKMATQAPGSRGSLGDSDGKHE TVNQEEKSGPGASGGSSGDPDGFFNSKVALFAAVGAGCVIFLLIIIFLTVLLLKLRKRHRKHTQQRAAAL SLSTLASPKGGSGTAGTEPSDIIIPLRTTENNYCPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 34.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004420 |
Locus ID | 1947 |
UniProt ID | P98172 |
Refseq Size | 3344 |
Cytogenetics | Xq13.1 |
Refseq ORF | 1038 |
Synonyms | CFND; CFNS; EFB1; EFL3; Elk-L; EPLG2; LERK2 |
Summary | The protein encoded by this gene is a type I membrane protein and a ligand of Eph-related receptor tyrosine kinases. It may play a role in cell adhesion and function in the development or maintenance of the nervous system. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Axon guidance |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401409 | EFNB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401409 | Transient overexpression lysate of ephrin-B1 (EFNB1) |
CNY 3,080.00 |
|
PH301886 | EFNB1 MS Standard C13 and N15-labeled recombinant protein (NP_004420) |
CNY 14,250.00 |
|
TP721089 | Purified recombinant protein of Human ephrin-B1 (EFNB1) |
CNY 4,360.00 |
其它Ephrin B1产品