C20orf30 (TMEM230) (NM_014145) Human Recombinant Protein
CAT#: TP301878
Recombinant protein of human chromosome 20 open reading frame 30 (C20orf30), transcript variant 3, 20 µg
View other "C20orf30" proteins (11)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201878 protein sequence
Red=Cloning site Green=Tags(s) MMPSRTNLATGIPSSKVKYSRLSSTDDGYIDLQFKKTPPKIPYKAIALATVLFLIGAFLIIIGSLLLSGY ISKGGADRAVPVLIIGILVFLPGFYHLRIAYYASKGYRAYSYDDIPDFDD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 13 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_054864 |
Locus ID | 29058 |
UniProt ID | Q96A57 |
Refseq Size | 1699 |
Cytogenetics | 20p13-p12.3 |
Refseq ORF | 360 |
Synonyms | C20orf30; dJ1116H23.2.1; HSPC274 |
Summary | This gene encodes a multi-pass transmembrane protein that belongs to the TMEM134/TMEM230 protein family. The encoded protein localizes to secretory and recycling vesicle in the neuron and may be involved in synaptic vesicles trafficking and recycling. Mutations in this gene may be linked to familial Parkinson's disease. [provided by RefSeq, Mar 2017] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415474 | TMEM230 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC423152 | TMEM230 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC423153 | TMEM230 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY415474 | Transient overexpression lysate of chromosome 20 open reading frame 30 (C20orf30), transcript variant 3 |
CN¥ 3,080.00 |
|
LY423152 | Transient overexpression lysate of chromosome 20 open reading frame 30 (C20orf30), transcript variant 2 |
CN¥ 3,080.00 |
|
LY423153 | Transient overexpression lysate of chromosome 20 open reading frame 30 (C20orf30), transcript variant 4 |
CN¥ 3,080.00 |
|
PH301878 | C20orf30 MS Standard C13 and N15-labeled recombinant protein (NP_054864) |
CN¥ 19,520.00 |
|
PH313024 | C20orf30 MS Standard C13 and N15-labeled recombinant protein (NP_001009924) |
CN¥ 19,520.00 |
|
PH324414 | C20orf30 MS Standard C13 and N15-labeled recombinant protein (NP_001009925) |
CN¥ 14,250.00 |
|
TP313024 | Recombinant protein of human chromosome 20 open reading frame 30 (C20orf30), transcript variant 2, 20 µg |
CN¥ 2,900.00 |
|
TP324414 | Purified recombinant protein of Homo sapiens chromosome 20 open reading frame 30 (C20orf30), transcript variant 4, 20 µg |
CN¥ 2,900.00 |
其它C20orf30产品