PLK1 (NM_005030) Human Recombinant Protein
CAT#: TP301795
Recombinant protein of human polo-like kinase 1 (Drosophila) (PLK1), 20 µg
View other "PLK1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 2 publications. |
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201795 representing NM_005030
Red=Cloning site Green=Tags(s) MSAAVTAGKLARAPADPGKAGVPGVAAPGAPAAAPPAKEIPEVLVDPRSRRRYVRGRFLGKGGFAKCFEI SDADTKEVFAGKIVPKSLLLKPHQREKMSMEISIHRSLAHQHVVGFHGFFEDNDFVFVVLELCRRRSLLE LHKRRKALTEPEARYYLRQIVLGCQYLHRNRVIHRDLKLGNLFLNEDLEVKIGDFGLATKVEYDGERKKT LCGTPNYIAPEVLSKKGHSFEVDVWSIGCIMYTLLVGKPPFETSCLKETYLRIKKNEYSIPKHINPVAAS LIQKMLQTDPTARPTINELLNDEFFTSGYIPARLPITCLTIPPRFSIAPSSLDPSNRKPLTVLNKGLENP LPERPREKEEPVVRETGEVVDCHLSDMLQQLHSVNASKPSERGLVRQEEAEDPACIPIFWVSKWVDYSDK YGLGYQLCDNSVGVLFNDSTRLILYNDGDSLQYIERDGTESYLTVSSHPNSLMKKITLLKYFRNYMSEHL LKAGANITPREGDELARLPYLRTWFRTRSAIILHLSNGSVQINFFQDHTKLILCPLMAAVTYIDEKRDFR TYRLSLLEEYGCCKELASRLRYARTMVDKLLSSRSASNRLKAS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 68.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | In vitro kinase assay substrate (ELISA) (PMID: 28024153) |
Reference Data | |
RefSeq | NP_005021 |
Locus ID | 5347 |
UniProt ID | P53350 |
Refseq Size | 2204 |
Cytogenetics | 16p12.2 |
Refseq ORF | 1809 |
Synonyms | PLK; STPK13 |
Summary | The Ser/Thr protein kinase encoded by this gene belongs to the CDC5/Polo subfamily. It is highly expressed during mitosis and elevated levels are found in many different types of cancer. Depletion of this protein in cancer cells dramatically inhibited cell proliferation and induced apoptosis; hence, it is a target for cancer therapy. [provided by RefSeq, Sep 2015] |
Protein Families | Druggable Genome, Protein Kinase |
Protein Pathways | Cell cycle, Oocyte meiosis, Progesterone-mediated oocyte maturation |
Citations (2)
The use of this Proteins has been cited in the following citations: |
---|
Synergistic apoptotic effect of miR-183-5p and Polo-Like kinase 1 inhibitor NMS-P937 in breast cancer cells
,null,
Cell Death and Differentiation
,PubMed ID 34561554
[PLK1]
|
HIV-1 blocks the signaling adaptor MAVS to evade antiviral host defense after sensing of abortive HIV-1 RNA by the host helicase DDX3
,Gringhuis, SI;Hertoghs, N;Kaptein, TM;Zijlstra-Willems, EM;Sarrami-Fooroshani, R;Sprokholt, JK;van Teijlingen, NH;Kootstra, NA;Booiman, T;van Dort, KA;Ribeiro, CM;Drewniak, A;Geijtenbeek, TB;,
Nat. Immunol
,PubMed ID 28024153
[PLK1]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417592 | PLK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417592 | Transient overexpression lysate of polo-like kinase 1 (Drosophila) (PLK1) |
CNY 3,080.00 |
|
PH301795 | PLK1 MS Standard C13 and N15-labeled recombinant protein (NP_005021) |
CNY 19,520.00 |