Hsp40 (DNAJB1) (NM_006145) Human Recombinant Protein
CAT#: TP301762
Recombinant protein of human DnaJ (Hsp40) homolog, subfamily B, member 1 (DNAJB1), 20 µg
View other "Hsp40" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201762 protein sequence
Red=Cloning site Green=Tags(s) MGKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFDRYGEE GLKGSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEEGMDIDDPFSGFPMGMGG FTNVNFGRSRSAQEPARKKQDPPVTHDLRVSLEEIYSGCTKKMKISHKRLNPDGKSIRNEDKILTIEVKK GWKEGTKITFPKEGDQTSNNIPADIVFVLKDKPHNIFKRDGSDVIYPARISLREALCGCTVNVPTLDGRT IPVVFKDVIRPGMRRKVPGEGLPLPKTPEKRGDLIIEFEVIFPERIPQTSRTVLEQVLPI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 37.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006136 |
Locus ID | 3337 |
UniProt ID | P25685 |
Refseq Size | 2419 |
Cytogenetics | 19p13.12 |
Refseq ORF | 1020 |
Synonyms | Hdj1; Hsp40; HSPF1; RSPH16B; Sis1 |
Summary | This gene encodes a member of the DnaJ or Hsp40 (heat shock protein 40 kD) family of proteins. DNAJ family members are characterized by a highly conserved amino acid stretch called the 'J-domain' and function as one of the two major classes of molecular chaperones involved in a wide range of cellular events, such as protein folding and oligomeric protein complex assembly. The encoded protein is a molecular chaperone that stimulates the ATPase activity of Hsp70 heat-shock proteins in order to promote protein folding and prevent misfolded protein aggregation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2015] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401851 | DNAJB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401851 | Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily B, member 1 (DNAJB1) |
CNY 3,080.00 |
|
PH301762 | DNAJB1 MS Standard C13 and N15-labeled recombinant protein (NP_006136) |
CNY 19,520.00 |
|
TP720929 | Purified recombinant protein of Human DnaJ (Hsp40) homolog, subfamily B, member 1 (DNAJB1) |
CNY 3,140.00 |