XTP3TPA (DCTPP1) (NM_024096) Human Recombinant Protein
CAT#: TP301727
Recombinant protein of human dCTP pyrophosphatase 1 (DCTPP1), 20 µg
View other "XTP3TPA" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201727 protein sequence
Red=Cloning site Green=Tags(s) MSVAGGEIRGDTGGEDTAAPGRFSFSPEPTLEDIRRLHAEFAAERDWEQFHQPRNLLLALVGEVGELAEL FQWKTDGEPGPQGWSPRERAALQEELSDVLIYLVALAARCRVDLPLAVLSKMDINRRRYPAHLARSSSRK YTELPHGAISEDQAVGPADIPCDSTGQTST myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 18.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_077001 |
Locus ID | 79077 |
UniProt ID | Q9H773 |
Refseq Size | 1143 |
Cytogenetics | 16p11.2 |
Refseq ORF | 510 |
Synonyms | CDA03; RS21C6; XTP3TPA |
Summary | The protein encoded by this gene is dCTP pyrophosphatase, which converts dCTP to dCMP and inorganic pyrophosphate. The encoded protein also displays weak activity against dTTP and dATP, but none against dGTP. This protein may be responsible for eliminating excess dCTP after DNA synthesis and may prevent overmethylation of CpG islands. Three transcript variants, one protein-coding and the other two non-protein coding, have been found for this gene. [provided by RefSeq, Dec 2015] |
Protein Families | Stem cell - Pluripotency |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411367 | DCTPP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411367 | Transient overexpression lysate of dCTP pyrophosphatase 1 (DCTPP1) |
CNY 3,080.00 |
|
PH301727 | DCTPP1 MS Standard C13 and N15-labeled recombinant protein (NP_077001) |
CNY 19,520.00 |
其它XTP3TPA产品