TFB2M (NM_022366) Human Recombinant Protein
CAT#: TP301683
Recombinant protein of human transcription factor B2, mitochondrial (TFB2M), nuclear gene encoding mitochondrial protein, 20 µg
View other "TFB2M" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201683 protein sequence
Red=Cloning site Green=Tags(s) MWIPVVGLPRRLRLSALAGAGRFCILGSEAATRKHLPARNHCGLSDSSPQLWPEPDFRNPPRKASKASLD FKRYVTDRRLAETLAQIYLGKPSRPPHLLLECNPGPGILTQALLEAGAKVVALESDKTFIPHLESLGKNL DGKLRVIHCDFFKLDPRSGGVIKPPAMSSRGLFKNLGIEAVPWTADIPLKVVGMFPSRGEKRALWKLAYD LYSCTSIYKFGRIEVNMFIGEKEFQKLMADPGNPDLYHVLSVIWQLACEIKVLHMEPWSSFDIYTRKGPL ENPKRRELLDQLQQKLYLIQMIPRQNLFTKNLTPMNYNIFFHLLKHCFGRRSATVIDHLRSLTPLDARDI LMQIGKQEDEKVVNMHPQDFKTLFETIERSKDCAYKWLYDETLEDR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 45.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_071761 |
Locus ID | 64216 |
UniProt ID | Q9H5Q4 |
Refseq Size | 1799 |
Cytogenetics | 1q44 |
Refseq ORF | 1188 |
Synonyms | Hkp1; mtTFB2 |
Summary | S-adenosyl-L-methionine-dependent methyltransferase which specifically dimethylates mitochondrial 12S rRNA at the conserved stem loop. Also required for basal transcription of mitochondrial DNA, probably via its interaction with POLRMT and TFAM. Stimulates transcription independently of the methyltransferase activity. Compared to TFB1M, it activates transcription of mitochondrial DNA more efficiently, while it has less methyltransferase activity.[UniProtKB/Swiss-Prot Function] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402922 | TFB2M HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402922 | Transient overexpression lysate of transcription factor B2, mitochondrial (TFB2M), nuclear gene encoding mitochondrial protein |
CNY 3,080.00 |
|
PH301683 | TFB2M MS Standard C13 and N15-labeled recombinant protein (NP_071761) |
CNY 14,250.00 |