TFB2M Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-TFB2M Antibody: synthetic peptide directed towards the N terminal of human TFB2M. Synthetic peptide located within the following region: ECNPGPGILTQALLEAGAKVVALESDKTFIPHLESLGKNLDGKLRVIHCD
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	45 kDa
Gene Name	transcription factor B2, mitochondrial
Database Link	NP_071761 Entrez Gene 64216 Human UniProt ID Q9H5Q4
Background	TFB2M is a S-adenosyl-L-methionine-dependent methyltransferase which specifically dimethylates mitochondrial 12S rRNA at the conserved stem loop. It is also required for basal transcription of mitochondrial DNA, probably via its interaction with POLRMT and TFAM. It stimulates transcription independently of the methyltransferase activity. Compared to TFB1M, it activates transcription of mitochondrial DNA more efficiently, while it has less methyltransferase activity.
Synonyms	Hkp1; mtTFB2
Note	Immunogen Sequence Homology: Horse: 100%; Human: 100%; Rat: 85%; Rabbit: 83%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.