PDK4 (NM_002612) Human Recombinant Protein
CAT#: TP301656
Recombinant protein of human pyruvate dehydrogenase kinase, isozyme 4 (PDK4), 20 µg
View other "PDK4" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Cited in 1 publication. |
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201656 protein sequence
Red=Cloning site Green=Tags(s) MKAARFVLRSAGSLNGAGLVPREVEHFSRYSPSPLSMKQLLDFGSENACERTSFAFLRQELPVRLANILK EIDILPTQLVNTSSVQLVKSWYIQSLMDLVEFHEKSPDDQKALSDFVDTLIKVRNRHHNVVPTMAQGIIE YKDACTVDPVTNQNLQYFLDRFYMNRISTRMLMNQHILIFSDSQTGNPSHIGSIDPNCDVVAVVQDAFEC SRMLCDQYYLSSPELKLTQVNGKFPDQPIHIVYVPSHLHHMLFELFKNAMRATVEHQENQPSLTPIEVIV VLGKEDLTIKISDRGGGVPLRIIDRLFSYTYSTAPTPVMDNSRNAPLAGFGYGLPISRLYAKYFQGDLNL YSLSGYGTDAIIYLKALSSESIEKLPVFNKSAFKHYQMSSEADDWCIPSREPKNLAKEVAM myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 46.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002603 |
Locus ID | 5166 |
UniProt ID | Q16654 |
Refseq Size | 3710 |
Cytogenetics | 7q21.3 |
Refseq ORF | 1233 |
Summary | This gene is a member of the PDK/BCKDK protein kinase family and encodes a mitochondrial protein with a histidine kinase domain. This protein is located in the matrix of the mitrochondria and inhibits the pyruvate dehydrogenase complex by phosphorylating one of its subunits, thereby contributing to the regulation of glucose metabolism. Expression of this gene is regulated by glucocorticoids, retinoic acid and insulin. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Protein Kinase |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Functional Consequences of PDK4 Deficiency in Doberman Pinscher Fibroblasts
,Bolfer, L;Estrada, AH;Larkin, C;Conlon, TJ;Lourenco, F;Taggart, K;Suzuki-Hatano, S;Pacak, CA;,
Sci Rep
,PubMed ID 32127618
[PDK4]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400924 | PDK4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400924 | Transient overexpression lysate of pyruvate dehydrogenase kinase, isozyme 4 (PDK4) |
CNY 3,080.00 |
|
PH301656 | PDK4 MS Standard C13 and N15-labeled recombinant protein (NP_002603) |
CNY 19,520.00 |