hnRNP U (HNRNPU) (NM_004501) Human Recombinant Protein
CAT#: TP301627
Recombinant protein of human heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A) (HNRNPU), transcript variant 2, 20 µg
View other "hnRNP U" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 3 publications. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201627 protein sequence
Red=Cloning site Green=Tags(s) MSSSPVNVKKLKVSELKEELKKRRLSDKGLKAELMERLQAALDDEEAGGRPAMEPGNGSLDLGGDSAGRS GAGLEQEAAAGGDEEEEEEEEEEEGISALDGDQMELGEENGAAGAADSGPMEEEEAASEDENGDDQGFQE GEDELGDEEEGAGDENGHGEQQPQPPATQQQQPQQQRGAAKEAAGKSSGPTSLFAVTVAPPGARQGQQQA GGDGKTEQKGGDKKRGVKRPREDHGRGYFEYIEENKYSRAKSPQPPVEEEDEHFDDTVVCLDTYNCDLHF KISRDRLSASSLTMESFAFLWAGGRASYGVSKGKVCFEMKVTEKIPVRHLYTKDIDIHEVRIGWSLTTSG MLLGEEEFSYGYSLKGIKTCNCETEDYGEKFDENDVITCFANFESDEVELSYAKNGQDLGVAFKISKEVL AGRPLFPHVLCHNCAVEFNFGQKEKPYFPIPEEYTFIQNVPLEDRVRGPKGPEEKKDCEVVMMIGLPGAG KTTWVTKHAAENPGKYNILGTNTIMDKMMVAGFKKQMADTGKLNTLLQRAPQCLGKFIEIAARKKRNFIL DQTNVSAAAQRRKMCLFAGFQRKAVVVCPKDEDYKQRTQKKAEVEGKDLPEHAVLKMKGNFTLPEVAECF DEITYVELQKEEAQKLLEQYKEESKKALPPEKKQNTGSKKSNKNKSGKNQFNRGGGHRGRGGFNMRGGNF RGGAPGNRGGYNRRGNMPQRGGGGGGSGGIGYPYPRAPVFPGRGSYSNRGNYNRGGMPNRGNYNQNFRGR GNNRGYKNQSQGYNQWQQGQFWGQKPWSQHYHQGYY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 88.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004492 |
Locus ID | 3192 |
UniProt ID | Q00839 |
Refseq Size | 6789 |
Cytogenetics | 1q44 |
Refseq ORF | 2418 |
Synonyms | DEE54; EIEE54; GRIP120; hnRNP U; HNRNPU-AS1; HNRPU; pp120; SAF-A; SAFA; U21.1 |
Summary | This gene encodes a member of a family of proteins that bind nucleic acids and function in the formation of ribonucleoprotein complexes in the nucleus with heterogeneous nuclear RNA (hnRNA). The encoded protein has affinity for both RNA and DNA, and binds scaffold-attached region (SAR) DNA. Mutations in this gene have been associated with epileptic encephalopathy, early infantile, 54. A pseudogene of this gene has been identified on chromosome 14. [provided by RefSeq, Jun 2017] |
Protein Families | Druggable Genome |
Protein Pathways | Spliceosome |
Citations (3)
The use of this Proteins has been cited in the following citations: |
---|
The RNA-binding protein hnRNPU regulates the sorting of microRNA-30c-5p into large extracellular vesicles
,null,
Journal of Extracellular Vesicles
,PubMed ID 32944175
[HNRNPU]
|
The RNA-binding protein hnRNPU regulates the sorting of microRNA-30c-5p into large extracellular vesicles
,Zietzer, A;Hosen, M;Wang, H;Goody, P;Sylvester, M;Latz, E;Nickenig, G;Werner, N;Jansen, F;,
Journal of Extracellular Vesicles
[HNRNPU]
|
DIRAS3 regulates the autophagosome initiation complex in dormant ovarian cancer cells
,null,
Autophagy
,PubMed ID 24879154
[HNRNPU]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401431 | HNRNPU HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401431 | Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A) (HNRNPU), transcript variant 2 |
CNY 3,080.00 |
|
PH301627 | HNRNPU MS Standard C13 and N15-labeled recombinant protein (NP_004492) |
CNY 19,520.00 |
其它hnRNP U产品