CHMP2B (NM_014043) Human Recombinant Protein
CAT#: TP301532
Recombinant protein of human chromatin modifying protein 2B (CHMP2B), 20 µg
View other "CHMP2B" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201532 representing NM_014043
Red=Cloning site Green=Tags(s) MASLFKKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAKIGNKEACKVLAKQLVHLRK QKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEE MINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKAPSAARSLPSASTSKATISDEEIERQLKAL GVD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 23.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_054762 |
Locus ID | 25978 |
UniProt ID | Q9UQN3 |
Refseq Size | 2410 |
Cytogenetics | 3p11.2 |
Refseq ORF | 639 |
Synonyms | ALS17; CHMP2.5; DMT1; FTDALS7; VPS2-2; VPS2B |
Summary | This gene encodes a component of the heteromeric ESCRT-III complex (Endosomal Sorting Complex Required for Transport III) that functions in the recycling or degradation of cell surface receptors. ESCRT-III functions in the concentration and invagination of ubiquitinated endosomal cargos into intralumenal vesicles. The protein encoded by this gene is found as a monomer in the cytosol or as an oligomer in ESCRT-III complexes on endosomal membranes. It is expressed in neurons of all major regions of the brain. Mutations in this gene result in one form of familial frontotemporal lobar degeneration. [provided by RefSeq, Jul 2008] |
Protein Pathways | Endocytosis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415517 | CHMP2B HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY415517 | Transient overexpression lysate of chromatin modifying protein 2B (CHMP2B) |
CN¥ 3,080.00 |
|
PH301532 | CHMP2B MS Standard C13 and N15-labeled recombinant protein (NP_054762) |
CN¥ 14,250.00 |