MOBK1B (MOB1A) (NM_018221) Human Recombinant Protein
CAT#: TP301487
Recombinant protein of human MOB1, Mps One Binder kinase activator-like 1B (yeast) (MOBKL1B), 20 µg
View other "MOBK1B" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201487 representing NM_018221
Red=Cloning site Green=Tags(s) MSFLFSSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRQAVMLPEGEDLNEWIAVNTVDFFNQINM LYGTITEFCTEASCPVMSAGPRYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPF PKNFMSVAKTILKRLFRVYAHIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEK LGSKDR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 24.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_060691 |
Locus ID | 55233 |
UniProt ID | Q9H8S9 |
Refseq Size | 2543 |
Cytogenetics | 2p13.1 |
Refseq ORF | 648 |
Synonyms | C2orf6; MATS1; MOB1; Mob4B; MOBK1B; MOBKL1B |
Summary | The protein encoded by this gene is a component of the Hippo signaling pathway, which controls organ size and tumor growth by enhancing apoptosis. Loss of the encoded protein results in cell proliferation and cancer formation. The encoded protein is also involved in the control of microtubule stability during cytokinesis. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2015] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413201 | MOB1A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413201 | Transient overexpression lysate of MOB1, Mps One Binder kinase activator-like 1B (yeast) (MOBKL1B) |
CNY 3,080.00 |
|
PH301487 | MOBKL1B MS Standard C13 and N15-labeled recombinant protein (NP_060691) |
CNY 19,520.00 |
|
TP720267 | Recombinant protein of human MOB1, Mps One Binder kinase activator-like 1B (yeast) (MOBKL1B) |
CNY 3,140.00 |