RPLP0 (NM_053275) Human Recombinant Protein
CAT#: TP301445
Recombinant protein of human ribosomal protein, large, P0 (RPLP0), transcript variant 2, 20 µg
View other "RPLP0" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201445 protein sequence
Red=Cloning site Green=Tags(s) MPREDRATWKSNYFLKIIQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGKAVVLMGKNTMMRKAIRGHLE NNPALEKLLPHIRGNVGFVFTKEDLTEIRDMLLANKVPAAARAGAIAPCEVTVPAQNTGLGPEKTSFFQA LGITTKISRGTIEILSDVQLIKTGDKVGASEATLLNMLNISPFSFGLVIQQVFDNGSIYNPEVLDITEET LHSRFLEGVRNVASVCLQIGYPTVASVPHSIINGYKRVLALSVETDYTFPLAEKVKAFLADPSAFVAAAP VAAATTAAPAAAAAPAKVEAKEESEESDEDMGFGLFD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 34.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_444505 |
Locus ID | 6175 |
UniProt ID | P05388, A0A024RBS2 |
Refseq Size | 1289 |
Cytogenetics | 12q24.23 |
Refseq ORF | 951 |
Synonyms | L10E; LP0; P0; PRLP0; RPP0 |
Summary | Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein, which is the functional equivalent of the E. coli L10 ribosomal protein, belongs to the L10P family of ribosomal proteins. It is a neutral phosphoprotein with a C-terminal end that is nearly identical to the C-terminal ends of the acidic ribosomal phosphoproteins P1 and P2. The P0 protein can interact with P1 and P2 to form a pentameric complex consisting of P1 and P2 dimers, and a P0 monomer. The protein is located in the cytoplasm. Transcript variants derived from alternative splicing exist; they encode the same protein. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. [provided by RefSeq, Jul 2008] |
Protein Pathways | Ribosome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403287 | RPLP0 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC424313 | RPLP0 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403287 | Transient overexpression lysate of ribosomal protein, large, P0 (RPLP0), transcript variant 2 |
CNY 3,080.00 |
|
LY424313 | Transient overexpression lysate of ribosomal protein, large, P0 (RPLP0), transcript variant 1 |
CNY 3,080.00 |
|
PH301445 | RPLP0 MS Standard C13 and N15-labeled recombinant protein (NP_444505) |
CNY 19,520.00 |