APPBP1 (NAE1) (NM_001018160) Human Recombinant Protein
CAT#: TP301326
Recombinant protein of human NEDD8 activating enzyme E1 subunit 1 (NAE1), transcript variant 3, 20 µg
View other "APPBP1" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201326 protein sequence
Red=Cloning site Green=Tags(s) MAQLGKLLKEQKYDRQLRLWGDHGQEALESAHVCLINATATGTEILKNLVLPGIGSFTIIDGNQVSGEDA GNNFFLQRSSIGKNRAEAAMEFLQELNSDVSGSFVEESPENLLDNDPSFFCRFTVVVATQLPESTSLRLA DVLWNSQIPLLICRTYGLVGYMRIIIKEHPVIESHPDNALEDLRLDKPFPELREHFQSYDLDHMEKKDHS HTPWIVIIAKYLAQWYSETNGRIPKTYKEKEDFRDLIRQGILKNENGAPEDEENFEEAIKNVNTALNTTQ IPSSIEDIFNDDRCINITKQTPSFWILARALKEFVAKEGQGNLPVRGTIPDMIADSGKYIKLQNVYREKA KKDAAAVGNHVAKLLQSIGQAPESISEKELKLLCSNSAFLRVVRCRSLAEEYGLDTINKDEIISSMDNPD NEIVLYLMLRAVDRFHKQQGRYPGVSNYQVEEDIGKLKSCLTGFLQEYGLSVMVKDDYVHEFCRYGAAEP HTIAAFLGGAAAQEVIKIITKQFVIFNNTYIYSGMSQTSATFQL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 50.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001018170 |
Locus ID | 8883 |
UniProt ID | Q13564 |
Refseq Size | 1716 |
Cytogenetics | 16q22.1 |
Refseq ORF | 1605 |
Synonyms | A-116A10.1; APPBP1; HPP1; ula-1 |
Summary | The protein encoded by this gene binds to the beta-amyloid precursor protein. Beta-amyloid precursor protein is a cell surface protein with signal-transducing properties, and it is thought to play a role in the pathogenesis of Alzheimer's disease. In addition, the encoded protein can form a heterodimer with UBE1C and bind and activate NEDD8, a ubiquitin-like protein. This protein is required for cell cycle progression through the S/M checkpoint. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Pathways | Alzheimer's disease |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418361 | NAE1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422668 | NAE1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418361 | Transient overexpression lysate of NEDD8 activating enzyme E1 subunit 1 (NAE1), transcript variant 1 |
CNY 3,080.00 |
|
LY422668 | Transient overexpression lysate of NEDD8 activating enzyme E1 subunit 1 (NAE1), transcript variant 3 |
CNY 3,080.00 |
|
PH301326 | NAE1 MS Standard C13 and N15-labeled recombinant protein (NP_001018170) |
CNY 19,520.00 |