UMPS (NM_000373) Human Recombinant Protein
CAT#: TP301324
Recombinant protein of human uridine monophosphate synthetase (UMPS), 20 µg
View other "UMPS" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Cited in 1 publication. |
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201324 protein sequence
Red=Cloning site Green=Tags(s) MAVARAALGPLVTGLYDVQAFKFGDFVLKSGLSSPIYIDLRGIVSRPRLLSQVADILFQTAQNAGISFDT VCGVPYTALPLATVICSTNQIPMLIRRKETKDYGTKRLVEGTINPGETCLIIEDVVTSGSSVLETVEVLQ KEGLKVTDAIVLLDREQGGKDKLQAHGIRLHSVCTLSKMLEILEQQKKVDAETVGRVKRFIQENVFVAAN HNGSPLSIKEAPKELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICML KTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGV VKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQ LEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLGV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 52 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | UMPS activity is verified in a bioassay: |
Reference Data | |
RefSeq | NP_000364 |
Locus ID | 7372 |
UniProt ID | P11172 |
Refseq Size | 6738 |
Cytogenetics | 3q21.2 |
Refseq ORF | 1440 |
Synonyms | OPRT |
Summary | This gene encodes a uridine 5'-monophosphate synthase. The encoded protein is a bifunctional enzyme that catalyzes the final two steps of the de novo pyrimidine biosynthetic pathway. The first reaction is carried out by the N-terminal enzyme orotate phosphoribosyltransferase which converts orotic acid to orotidine-5'-monophosphate. The terminal reaction is carried out by the C-terminal enzyme OMP decarboxylase which converts orotidine-5'-monophosphate to uridine monophosphate. Defects in this gene are the cause of hereditary orotic aciduria. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Mar 2010] |
Protein Families | Druggable Genome |
Protein Pathways | Drug metabolism - other enzymes, Metabolic pathways, Pyrimidine metabolism |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Metabolomics Identifies Pyrimidine Starvation as the Mechanism of 5-Aminoimidazole-4-Carboxamide-1-ß-Riboside-Induced Apoptosis in Multiple Myeloma Cells
,Carolyne Bardeleben, Sanjai Sharma, Joseph R. Reeve, Sara Bassilian, Patrick Frost, Bao Hoang, Yijiang Shi, and Alan Lichtenstein,
Mol. Cancer Ther., Jul 2013; 12: 1310 - 1321.
,PubMed ID 23585020
[UMPS]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424757 | UMPS HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY424757 | Transient overexpression lysate of uridine monophosphate synthetase (UMPS) |
CN¥ 3,080.00 |
|
PH301324 | UMPS MS Standard C13 and N15-labeled recombinant protein (NP_000364) |
CN¥ 19,520.00 |