LENG4 (MBOAT7) (NM_024298) Human Recombinant Protein
CAT#: TP301320
Recombinant protein of human membrane bound O-acyltransferase domain containing 7 (MBOAT7), 20 µg
View other "LENG4" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201320 protein sequence
Red=Cloning site Green=Tags(s) MSPEEWTYLVVLLISIPIGFLFKKAGPGLKRWGAAAVGLGLTLFTCGPHTLHSLVTILGTWALIQAQPCS CHALALAWTFSYLLFFRALSLLGLPTPTPFTNAVQLLLTLKLVSLASEVQDLHLAQRKEMASGFSKGPTL GLLPDVPSLMETLSYSYCYVGIMTGPFFRYRTYLDWLEQPFPGAVPSLRPLLRRAWPAPLFGLLFLLSSH LFPLEAVREDAFYARPLPARLFYMIPVFFAFRMRFYVAWIAAECGCIAAGFGAYPVAAKARAGGGPTLQC PPPSSPEKAASLEYDYETIRNIDCYSTDFCVRVRDGMRYWNMTVQWWLAQYIYKSAPARSYVLRSAWTML LSAYWHGLHPGYYLSFLTIPLCLAAEGRLESALRGRLSPGGQKAWDWVHWFLKMRAYDYMCMGFVLLSLA DTLRYWASIYFCIHFLALAALGLGLALGGGSPSRRKAASQPTSLAPEKLREE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 52.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_077274 |
Locus ID | 79143 |
UniProt ID | Q96N66 |
Refseq Size | 2616 |
Cytogenetics | 19q13.42 |
Refseq ORF | 1416 |
Synonyms | BB1; hMBOA-7; LENG4; LPIAT; LPLAT; LRC4; MBOA7; MRT57; OACT7 |
Summary | This gene encodes a member of the membrane-bound O-acyltransferases family of integral membrane proteins that have acyltransferase activity. The encoded protein is a lysophosphatidylinositol acyltransferase that has specificity for arachidonoyl-CoA as an acyl donor. This protein is involved in the reacylation of phospholipids as part of the phospholipid remodeling pathway known as the Land cycle. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2009] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411319 | MBOAT7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431861 | MBOAT7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411319 | Transient overexpression lysate of membrane bound O-acyltransferase domain containing 7 (MBOAT7), transcript variant 1 |
CNY 3,080.00 |
|
LY431861 | Transient overexpression lysate of membrane bound O-acyltransferase domain containing 7 (MBOAT7), transcript variant 4 |
CNY 3,080.00 |
|
PH301320 | MBOAT7 MS Standard C13 and N15-labeled recombinant protein (NP_077274) |
CNY 14,250.00 |