Aminoacylase 1 (ACY1) (NM_000666) Human Recombinant Protein
CAT#: TP301284
Recombinant protein of human aminoacylase 1 (ACY1), 20 µg
View other "Aminoacylase 1" proteins (10)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201284 protein sequence
Red=Cloning site Green=Tags(s) MTSKGPEEEHPSVTLFRQYLRIRTVQPKPDYGAAVAFFEETARQLGLGCQKVEVAPGYVVTVLTWPGTNP TLSSILLNSHTDVVPVFKEHWSHDPFEAFKDSEGYIYARGAQDMKCVSIQYLEAVRRLKVEGHRFPRTIH MTFVPDEEVGGHQGMELFVQRPEFHALRAGFALDEGIANPTDAFTVFYSERSPWWVRVTSTGRPGHASRF MEDTAAEKLHKVVNSILAFREKEWQRLQSNPHLKEGSVTSVNLTKLEGGVAYNVIPATMSASFDFRVAPD VDFKAFEEQLQSWCQAAGEGVTLEFAQKWMHPQVTPTDDSNPWWAAFSRVCKDMNLTLEPEIMPAATDNR YIRAVGVPALGFSPMNRTPVLLHDHDERLHEAVFLRGVDIYTRLLPALASVPALPSDS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 45.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_000657 |
Locus ID | 95 |
UniProt ID | Q03154, V9HWA0 |
Refseq Size | 1678 |
Cytogenetics | 3p21.2 |
Refseq ORF | 1224 |
Synonyms | ACY-1; ACY1D; HEL-S-5 |
Summary | This gene encodes a cytosolic, homodimeric, zinc-binding enzyme that catalyzes the hydrolysis of acylated L-amino acids to L-amino acids and an acyl group, and has been postulated to function in the catabolism and salvage of acylated amino acids. This gene is located on chromosome 3p21.1, a region reduced to homozygosity in small-cell lung cancer (SCLC), and its expression has been reported to be reduced or undetectable in SCLC cell lines and tumors. The amino acid sequence of human aminoacylase-1 is highly homologous to the porcine counterpart, and this enzyme is the first member of a new family of zinc-binding enzymes. Mutations in this gene cause aminoacylase-1 deficiency, a metabolic disorder characterized by central nervous system defects and increased urinary excretion of N-acetylated amino acids. Alternative splicing of this gene results in multiple transcript variants. Read-through transcription also exists between this gene and the upstream ABHD14A (abhydrolase domain containing 14A) gene, as represented in GeneID:100526760. A related pseudogene has been identified on chromosome 18. [provided by RefSeq, Nov 2010] |
Protein Families | Protease |
Protein Pathways | Arginine and proline metabolism, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424578 | ACY1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC434169 | ACY1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC434175 | ACY1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC434192 | ACY1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY424578 | Transient overexpression lysate of aminoacylase 1 (ACY1) |
CNY 3,080.00 |
|
LY434169 | Transient overexpression lysate of aminoacylase 1 (ACY1), transcript variant 3 |
CNY 3,080.00 |
|
LY434175 | Transient overexpression lysate of aminoacylase 1 (ACY1), transcript variant 4 |
CNY 3,080.00 |
|
LY434192 | Transient overexpression lysate of aminoacylase 1 (ACY1), transcript variant 5 |
CNY 3,080.00 |
|
PH301284 | ACY1 MS Standard C13 and N15-labeled recombinant protein (NP_000657) |
CNY 19,520.00 |
|
TP710321 | Purified recombinant protein of Human aminoacylase 1 (ACY1), transcript variant 1, full length, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4,020.00 |
其它Aminoacylase 1产品