APPD (PLEKHF1) (NM_024310) Human Recombinant Protein
CAT#: TP301282
Recombinant protein of human pleckstrin homology domain containing, family F (with FYVE domain) member 1 (PLEKHF1), 20 µg
View other "APPD" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201282 protein sequence
Red=Cloning site Green=Tags(s) MVDHLANTEINSQRIAAVESCFGASGQPLALPGRVLLGEGVLTKECRKKAKPRIFFLFNDILVYGSIVLN KRKYRSQHIIPLEEVTLELLPETLQAKNRWMIKTAKKSFVVSAASATERQEWISHIEECVRRQLRATGRP PSTEHAAPWIPDKATDICMRCTQTRFSALTRRHHCRKCGFVVCAECSRQRFLLPRLSPKPVRVCSLCYRE LAAQQRQEEAEEQGAGSPGQPAHLARPICGASSGDDDDSDEDKEGSRDGDWPSSVEFYASGVAWSAFHS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 31 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_077286 |
Locus ID | 79156 |
UniProt ID | Q96S99 |
Refseq Size | 1774 |
Cytogenetics | 19q12 |
Refseq ORF | 837 |
Synonyms | APPD; LAPF; PHAFIN1; ZFYVE15 |
Summary | May induce apoptosis through the lysosomal-mitochondrial pathway. Translocates to the lysosome initiating the permeabilization of lysosomal membrane (LMP) and resulting in the release of CTSD and CTSL to the cytoplasm. Triggers the caspase-independent apoptosis by altering mitochondrial membrane permeabilization (MMP) resulting in the release of PDCD8.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402983 | PLEKHF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402983 | Transient overexpression lysate of pleckstrin homology domain containing, family F (with FYVE domain) member 1 (PLEKHF1) |
CNY 3,080.00 |
|
PH301282 | PLEKHF1 MS Standard C13 and N15-labeled recombinant protein (NP_077286) |
CNY 14,250.00 |