COMT (NM_000754) Human Recombinant Protein
CAT#: TP301275
Purified recombinant protein of Homo sapiens catechol-O-methyltransferase (COMT), transcript variant 1, 20 µg
View other "COMT" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201275 protein sequence
Red=Cloning site Green=Tags(s) MNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGMK DKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDF LAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGPGSEAGP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 29.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_000745 |
Locus ID | 1312 |
UniProt ID | P21964 |
Refseq Size | 2304 |
Cytogenetics | 22q11.21 |
Refseq ORF | 546 |
Synonyms | HEL-S-98n |
Summary | Catechol-O-methyltransferase catalyzes the transfer of a methyl group from S-adenosylmethionine to catecholamines, including the neurotransmitters dopamine, epinephrine, and norepinephrine. This O-methylation results in one of the major degradative pathways of the catecholamine transmitters. In addition to its role in the metabolism of endogenous substances, COMT is important in the metabolism of catechol drugs used in the treatment of hypertension, asthma, and Parkinson disease. COMT is found in two forms in tissues, a soluble form (S-COMT) and a membrane-bound form (MB-COMT). The differences between S-COMT and MB-COMT reside within the N-termini. Several transcript variants are formed through the use of alternative translation initiation sites and promoters. [provided by RefSeq, Sep 2008] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Metabolic pathways, Tyrosine metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400254 | COMT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400254 | Transient overexpression lysate of catechol-O-methyltransferase (COMT), transcript variant 1 |
CNY 3,080.00 |
|
PH301275 | COMT MS Standard C13 and N15-labeled recombinant protein (NP_000745) |
CNY 14,250.00 |
|
PH304127 | COMT MS Standard C13 and N15-labeled recombinant protein (NP_009294) |
CNY 19,520.00 |
|
TP304127 | Recombinant protein of human catechol-O-methyltransferase (COMT), transcript variant 4, 20 µg |
CNY 2,900.00 |