PSME1 (NM_006263) Human Recombinant Protein
CAT#: TP301260
Recombinant protein of human proteasome (prosome, macropain) activator subunit 1 (PA28 alpha) (PSME1), transcript variant 1, 20 µg
View other "PSME1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201260 protein sequence
Red=Cloning site Green=Tags(s) MAMLRVQPEAQAKVDVFREDLCTKTENLLGSYFPKKISELDAFLKEPALNEANLSNLKAPLDIPVPDPVK EKEKEERKKQQEKEDKDEKKKGEDEDKGPPCGPVNCNEKIVVLLQRLKPEIKDVIEQLNLVTTWLQLQIP RIEDGNNFGVAVQEKVFELMTSLHTKLEGFHTQISKYFSERGDAVTKAAKQPHVGDYRQLVHELDEAEYR DIRLMVMEIRNAYAVLYDIILKNFEKLKKPRGETKGMIY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 28.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006254 |
Locus ID | 5720 |
UniProt ID | Q06323 |
Refseq Size | 1023 |
Cytogenetics | 14q12 |
Refseq ORF | 747 |
Synonyms | HEL-S-129m; IFI5111; PA28A; PA28alpha; REGalpha |
Summary | The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. The immunoproteasome contains an alternate regulator, referred to as the 11S regulator or PA28, that replaces the 19S regulator. Three subunits (alpha, beta and gamma) of the 11S regulator have been identified. This gene encodes the alpha subunit of the 11S regulator, one of the two 11S subunits that is induced by gamma-interferon. Three alpha and three beta subunits combine to form a heterohexameric ring. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013] |
Protein Pathways | Antigen processing and presentation, Proteasome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401886 | PSME1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401886 | Transient overexpression lysate of proteasome (prosome, macropain) activator subunit 1 (PA28 alpha) (PSME1), transcript variant 1 |
CNY 3,080.00 |
|
PH301260 | PSME1 MS Standard C13 and N15-labeled recombinant protein (NP_006254) |
CNY 19,520.00 |