PRC1 (NM_003981) Human Recombinant Protein
CAT#: TP301141
Recombinant protein of human protein regulator of cytokinesis 1 (PRC1), transcript variant 1, 20 µg
View other "PRC1" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201141 protein sequence
Red=Cloning site Green=Tags(s) MRRSEVLAEESIVCLQKALNHLREIWELIGIPEDQRLQRTEVVKKHIKELLDMMIAEEESLKERLIKSIS VCQKELNTLCSELHVEPFQEEGETTILQLEKDLRTQVELMRKQKKERKQELKLLQEQDQELCEILCMPHY DIDSASVPSLEELNQFRQHVTTLRETKASRREEFVSIKRQIILCMEELDHTPDTSFERDVVCEDEDAFCL SLENIATLQKLLRQLEMQKSQNEAVCEGLRTQIRELWDRLQIPEEEREAVATIMSGSKAKVRKALQLEVD RLEELKMQNMKKVIEAIRVELVQYWDQCFYSQEQRQAFAPFCAEDYTESLLQLHDAEIVRLKNYYEVHKE LFEGVQKWEETWRLFLEFERKASDPNRFTNRGGNLLKEEKQRAKLQKMLPKLEEELKARIELWEQEHSKA FMVNGQKFMEYVAEQWEMHRLEKERAKQERQLKNKKQTETEMLYGSAPRTPSKRRGLAPNTPGKARKLNT TTMSNATANSSIRPIFGGTVYHSPVSRLPPSGSKPVAASTCSGKKTPRTGRHGANKENLELNGSILSGGY PGSAPLQRNFSINSVASTYSEFAKDPSLSDSSTVGLQRELSKASKSDATSGILNSTNIQS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 71.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003972 |
Locus ID | 9055 |
UniProt ID | O43663, A0A024RC67 |
Refseq Size | 3207 |
Cytogenetics | 15q26.1 |
Refseq ORF | 1860 |
Synonyms | ASE1 |
Summary | This gene encodes a protein that is involved in cytokinesis. The protein is present at high levels during the S and G2/M phases of mitosis but its levels drop dramatically when the cell exits mitosis and enters the G1 phase. It is located in the nucleus during interphase, becomes associated with mitotic spindles in a highly dynamic manner during mitosis, and localizes to the cell mid-body during cytokinesis. This protein has been shown to be a substrate of several cyclin-dependent kinases (CDKs). It is necessary for polarizing parallel microtubules and concentrating the factors responsible for contractile ring assembly. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2012] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404548 | PRC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC404549 | PRC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC418307 | PRC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404548 | Transient overexpression lysate of protein regulator of cytokinesis 1 (PRC1), transcript variant 2 |
CNY 4,840.00 |
|
LY404549 | Transient overexpression lysate of protein regulator of cytokinesis 1 (PRC1), transcript variant 3 |
CNY 4,840.00 |
|
LY418307 | Transient overexpression lysate of protein regulator of cytokinesis 1 (PRC1), transcript variant 1 |
CNY 3,080.00 |
|
PH301141 | PRC1 MS Standard C13 and N15-labeled recombinant protein (NP_003972) |
CNY 19,520.00 |