United States
Germany
Japan
United Kingdom
China
ASS1 (NM_054012) Human Recombinant Protein
CAT＃: TP301130
Recombinant protein of human argininosuccinate synthetase 1 (ASS1), transcript variant 2, 20 µg
View other "ASS1" proteins (8)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 1,999.00
CNY 2,700.00
热销推荐CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC201130 protein sequence
Red=Cloning site Green=Tags(s) MSSKGSVVLAYSGGLDTSCILVWLKEQGYDVIAYLANIGQKEDFEEARKKALKLGAKKVFIEDVSREFVE EFIWPAIQSSALYEDRYLLGTSLARPCIARKQVEIAQREGAKYVSHGATGKGNDQVRFELSCYSLAPQIK VIAPWRMPEFYNRFKGRNDLMEYAKQHGIPIPVTPKNPWSMDENLMHISYEAGILENPKNQAPPGLYTKT QDPAKAPNTPDILEIEFKKGVPVKVTNVKDGTTHQTSLELFMYLNEVAGKHGVGRIDIVENRFIGMKSRG IYETPAGTILYHAHLDIEAFTMDREVRKIKQGLGLKFAELVYTGFWHSPECEFVRHCIAKSQERVEGKVQ VSVLKGQVYILGRESPLSLYNEELVSMNVQGDYEPTDATGFININSLRLKEYHRLQSKVTAK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 46.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_446464 |
| Locus ID | 445 |
| UniProt ID | P00966 |
| Refseq Size | 1801 |
| Cytogenetics | 9q34.11 |
| Refseq ORF | 1236 |
| Synonyms | ASS; CTLN1 |
| Summary | The protein encoded by this gene catalyzes the penultimate step of the arginine biosynthetic pathway. There are approximately 10 to 14 copies of this gene including the pseudogenes scattered across the human genome, among which the one located on chromosome 9 appears to be the only functional gene for argininosuccinate synthetase. Mutations in the chromosome 9 copy of this gene cause citrullinemia. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Aug 2012] |
| Protein Families | Druggable Genome |
| Protein Pathways | Alanine, aspartate and glutamate metabolism, Arginine and proline metabolism, Metabolic pathways |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403289 | ASS1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC424955 | ASS1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403289 | Transient overexpression lysate of argininosuccinate synthetase 1 (ASS1), transcript variant 2 |
CNY 3,080.00 |
|
| LY424955 | Transient overexpression lysate of argininosuccinate synthetase 1 (ASS1), transcript variant 1 |
CNY 3,080.00 |
|
| PH301130 | ASS1 MS Standard C13 and N15-labeled recombinant protein (NP_446464) |
CNY 19,520.00 |
|
| PH323189 | ASS1 MS Standard C13 and N15-labeled recombinant protein (NP_000041) |
CNY 19,520.00 |
|
| TP323189 | Recombinant protein of human argininosuccinate synthetase 1 (ASS1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP720522 | Recombinant protein of human argininosuccinate synthetase 1 (ASS1), transcript variant 1 |
CNY 3,140.00 |
