AP3S2 (NM_005829) Human Recombinant Protein
CAT#: TP301104
Recombinant protein of human adaptor-related protein complex 3, sigma 2 subunit (AP3S2), 20 µg
View other "AP3S2" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201104 protein sequence
Red=Cloning site Green=Tags(s) MIQAILVFNNHGKPRLVRFYQRFPEEIQQQIVRETFHLVLKRDDNICNFLEGGSLIGGSDYKLIYRHYAT LYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHMDKVHYILQEVVMGGMVLETNMNEIVAQ IEAQNRLEKSEGGLSAAPARAVSAVKNINLPEIPRNINIGDLNIKVPNLSQFV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 21.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005820 |
Locus ID | 10239 |
UniProt ID | P59780 |
Refseq Size | 5934 |
Cytogenetics | 15q26.1 |
Refseq ORF | 579 |
Synonyms | AP3S3; sigma3b |
Summary | Part of the AP-3 complex, an adaptor-related complex which is not clathrin-associated. The complex is associated with the Golgi region as well as more peripheral structures. It facilitates the budding of vesicles from the Golgi membrane and may be directly involved in trafficking to lysosomes. In concert with the BLOC-1 complex, AP-3 is required to target cargos into vesicles assembled at cell bodies for delivery into neurites and nerve terminals.[UniProtKB/Swiss-Prot Function] |
Protein Pathways | Lysosome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417043 | AP3S2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417043 | Transient overexpression lysate of adaptor-related protein complex 3, sigma 2 subunit (AP3S2) |
CNY 3,080.00 |
|
PH301104 | AP3S2 MS Standard C13 and N15-labeled recombinant protein (NP_005820) |
CNY 19,520.00 |