AP3S2 (NM_005829) Human Mass Spec Standard
CAT#: PH301104
AP3S2 MS Standard C13 and N15-labeled recombinant protein (NP_005820)
View other "AP3S2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | AP3S2 MS Standard C13 and N15-labeled recombinant protein (NP_005820) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201104 |
Predicted MW | 22 kDa |
Protein Sequence |
>RC201104 protein sequence
Red=Cloning site Green=Tags(s) MIQAILVFNNHGKPRLVRFYQRFPEEIQQQIVRETFHLVLKRDDNICNFLEGGSLIGGSDYKLIYRHYAT LYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHMDKVHYILQEVVMGGMVLETNMNEIVAQ IEAQNRLEKSEGGLSAAPARAVSAVKNINLPEIPRNINIGDLNIKVPNLSQFV myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005820 |
RefSeq Size | 5934 |
RefSeq ORF | 579 |
Synonyms | AP3S3; sigma3b |
Locus ID | 10239 |
Cytogenetics | 15q26.1 |
Summary | Part of the AP-3 complex, an adaptor-related complex which is not clathrin-associated. The complex is associated with the Golgi region as well as more peripheral structures. It facilitates the budding of vesicles from the Golgi membrane and may be directly involved in trafficking to lysosomes. In concert with the BLOC-1 complex, AP-3 is required to target cargos into vesicles assembled at cell bodies for delivery into neurites and nerve terminals.[UniProtKB/Swiss-Prot Function] |
Protein Pathways | Lysosome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417043 | AP3S2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417043 | Transient overexpression lysate of adaptor-related protein complex 3, sigma 2 subunit (AP3S2) |
CNY 3,080.00 |
|
TP301104 | Recombinant protein of human adaptor-related protein complex 3, sigma 2 subunit (AP3S2), 20 µg |
CNY 2,900.00 |