Acid Phosphatase (ACP1) (NM_007099) Human Recombinant Protein
CAT#: TP301078
Recombinant protein of human acid phosphatase 1, soluble (ACP1), transcript variant 2, 20 µg
View other "Acid Phosphatase" proteins (8)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201078 protein sequence
Red=Cloning site Green=Tags(s) MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWVIDSGAVSDWNVGRSPDPRAVSCLRNHGIH TAHKARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFE TVYQQCVRCCRAFLEKAH myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 17.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_009030 |
Locus ID | 52 |
UniProt ID | P24666 |
Refseq Size | 1568 |
Cytogenetics | 2p25.3 |
Refseq ORF | 474 |
Synonyms | HAAP; LMW-PTP; LMWPTP |
Summary | The product of this gene belongs to the phosphotyrosine protein phosphatase family of proteins. It functions as an acid phosphatase and a protein tyrosine phosphatase by hydrolyzing protein tyrosine phosphate to protein tyrosine and orthophosphate. This enzyme also hydrolyzes orthophosphoric monoesters to alcohol and orthophosphate. This gene is genetically polymorphic, and three common alleles segregating at the corresponding locus give rise to six phenotypes. Each allele appears to encode at least two electrophoretically different isozymes, Bf and Bs, which are produced in allele-specific ratios. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Aug 2008] |
Protein Families | Druggable Genome, Phosphatase, Transmembrane |
Protein Pathways | Adherens junction, Riboflavin metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402090 | ACP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC418090 | ACP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY402090 | Transient overexpression lysate of acid phosphatase 1, soluble (ACP1), transcript variant 2 |
CN¥ 3,080.00 |
|
LY418090 | Transient overexpression lysate of acid phosphatase 1, soluble (ACP1), transcript variant 3 |
CN¥ 3,080.00 |
|
PH301078 | ACP1 MS Standard C13 and N15-labeled recombinant protein (NP_009030) |
CN¥ 19,520.00 |
|
PH312653 | ACP1 MS Standard C13 and N15-labeled recombinant protein (NP_004291) |
CN¥ 19,520.00 |
|
TP312653 | Recombinant protein of human acid phosphatase 1, soluble (ACP1), transcript variant 3, 20 µg |
CN¥ 2,900.00 |
|
TP720178 | Recombinant protein of human acid phosphatase 1, soluble (ACP1), transcript variant 3 |
CN¥ 1,800.00 |
其它Acid Phosphatase产品