PSMC3IP (NM_013290) Human Recombinant Protein
CAT#: TP301045
Recombinant protein of human PSMC3 interacting protein (PSMC3IP), transcript variant 1, 20 µg
View other "PSMC3IP" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201045 protein sequence
Red=Cloning site Green=Tags(s) MSKGRAEAAAGAAGILLRYLQEQNRPYSSQDVFGNLQREHGLGKAVVVKTLEQLAQQGKIKEKMYGKQKI YFADQDQFDMVSDADLQVLDGKIVALTAKVQSLQQSCRYMEAEMQKEIQELKKECAGYRERLKNIKAATN HVTPEEKEQVYRERQKYCKEWRKRKRMATELSDAILEGYPKSKKQFFEEVGIETDEDYNVTLPDP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 23.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_037422 |
Locus ID | 29893 |
UniProt ID | Q9P2W1 |
Refseq Size | 1440 |
Cytogenetics | 17q21.2 |
Refseq ORF | 615 |
Synonyms | GT198; HOP2; HUMGT198A; ODG3; TBPIP |
Summary | This gene encodes a protein that functions in meiotic recombination. It is a subunit of the PSMC3IP/MND1 complex, which interacts with PSMC3/TBP1 to stimulate DMC1- and RAD51-mediated strand exchange during meiosis. The protein encoded by this gene can also co-activate ligand-driven transcription mediated by estrogen, androgen, glucocorticoid, progesterone, and thyroid nuclear receptors. Mutations in this gene cause XX female gonadal dysgenesis. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Dec 2011] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415686 | PSMC3IP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415686 | Transient overexpression lysate of PSMC3 interacting protein (PSMC3IP), transcript variant 1 |
CNY 3,080.00 |
|
PH301045 | PSMC3IP MS Standard C13 and N15-labeled recombinant protein (NP_037422) |
CNY 19,520.00 |
其它PSMC3IP产品