PSMC3IP (NM_013290) Human Mass Spec Standard
CAT#: PH301045
PSMC3IP MS Standard C13 and N15-labeled recombinant protein (NP_037422)
View other "PSMC3IP" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | PSMC3IP MS Standard C13 and N15-labeled recombinant protein (NP_037422) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201045 |
Predicted MW | 23.6 kDa |
Protein Sequence |
>RC201045 protein sequence
Red=Cloning site Green=Tags(s) MSKGRAEAAAGAAGILLRYLQEQNRPYSSQDVFGNLQREHGLGKAVVVKTLEQLAQQGKIKEKMYGKQKI YFADQDQFDMVSDADLQVLDGKIVALTAKVQSLQQSCRYMEAEMQKEIQELKKECAGYRERLKNIKAATN HVTPEEKEQVYRERQKYCKEWRKRKRMATELSDAILEGYPKSKKQFFEEVGIETDEDYNVTLPDP myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_037422 |
RefSeq Size | 1440 |
RefSeq ORF | 615 |
Synonyms | GT198; HOP2; HUMGT198A; ODG3; TBPIP |
Locus ID | 29893 |
Cytogenetics | 17q21.2 |
Summary | This gene encodes a protein that functions in meiotic recombination. It is a subunit of the PSMC3IP/MND1 complex, which interacts with PSMC3/TBP1 to stimulate DMC1- and RAD51-mediated strand exchange during meiosis. The protein encoded by this gene can also co-activate ligand-driven transcription mediated by estrogen, androgen, glucocorticoid, progesterone, and thyroid nuclear receptors. Mutations in this gene cause XX female gonadal dysgenesis. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Dec 2011] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415686 | PSMC3IP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415686 | Transient overexpression lysate of PSMC3 interacting protein (PSMC3IP), transcript variant 1 |
CNY 3,080.00 |
|
TP301045 | Recombinant protein of human PSMC3 interacting protein (PSMC3IP), transcript variant 1, 20 µg |
CNY 2,900.00 |
其它PSMC3IP产品