Suppressor of Fused (SUFU) (NM_016169) Human Recombinant Protein
CAT#: TP301021
Recombinant protein of human suppressor of fused homolog (Drosophila) (SUFU), 20 µg
View other "Suppressor of Fused" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201021 protein sequence
Red=Cloning site Green=Tags(s) MAELRPSGAPGPTAPPAPGPTAPPAFASLFPPGLHAIYGECRRLYPDQPNPLQVTAIVKYWLGGPDPLDY VSMYRNVGSPSANIPEHWHYISFGLSDLYGDNRVHEFTGTDGPSGFGFELTFRLKRETGESAPPTWPAEL MQGLARYVFQSENTFCSGDHVSWHSPLDNSESRIQHMLLTEDPQMQPVQTPFGVVTFLQIVGVCTEELHS AQQWNGQGILELLRTVPIAGGPWLITDMRRGETIFEIDPHLQERVDKGIETDGSNLSGVSAKCAWDDLSR PPEDDEDSRSICIGTQPRRLSGKDTEQIRETLRRGLEINSKPVLPPINPQRQNGLAHDRAPSRKDSLESD SSTAIIPHELIRTRQLESVHLKFNQESGALIPLCLRGRLLHGRHFTYKSITGDMAITFVSTGVEGAFATE EHPYAAHGPWLQILLTEEFVEKMLEDLEDLTSPEEFKLPKEYSWPEKKLKVSILPDVVFDSPLH myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 53.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057253 |
Locus ID | 51684 |
UniProt ID | Q9UMX1 |
Refseq Size | 4994 |
Cytogenetics | 10q24.32 |
Refseq ORF | 1452 |
Synonyms | JBTS32; PRO1280; SUFUH; SUFUXL |
Summary | The Hedgehog signaling pathway plays an important role in early human development. The pathway is a signaling cascade that plays a role in pattern formation and cellular proliferation during development. This gene encodes a negative regulator of the hedgehog signaling pathway. Defects in this gene are a cause of medulloblastoma. Alternative splicing results in multiple transcript variants.[provided by RefSeq, May 2010] |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | Basal cell carcinoma, Hedgehog signaling pathway, Pathways in cancer |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402511 | SUFU HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402511 | Transient overexpression lysate of suppressor of fused homolog (Drosophila) (SUFU) |
CNY 3,080.00 |
|
PH301021 | SUFU MS Standard C13 and N15-labeled recombinant protein (NP_057253) |
CNY 19,520.00 |
其它Suppressor of Fused产品