JAB1 (COPS5) (NM_006837) Human Recombinant Protein
CAT#: TP300979
Recombinant protein of human COP9 constitutive photomorphogenic homolog subunit 5 (Arabidopsis) (COPS5), 20 µg
View other "JAB1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
Cited in 2 publications. |
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200979 protein sequence
Red=Cloning site Green=Tags(s) MAASGSGMAQKTWELANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHYFKYCKISALALLKMVMHAR SGGNLEVMGLMLGKVDGETMIIMDSFALPVEGTETRVNAQAAAYEYMAAYIENAKQVGRLENAIGWYHSH PGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYPKGYKPPDEGPSEYQTIPLNK IEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLEQSEAQL GRGSFMLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQINIS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 37.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006828 |
Locus ID | 10987 |
UniProt ID | Q92905 |
Refseq Size | 1510 |
Cytogenetics | 8q13.1 |
Refseq ORF | 1002 |
Synonyms | CSN5; JAB1; MOV-34; SGN5 |
Summary | The protein encoded by this gene is one of the eight subunits of COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases. This protein is reported to be involved in the degradation of cyclin-dependent kinase inhibitor CDKN1B/p27Kip1. It is also known to be an coactivator that increases the specificity of JUN/AP1 transcription factors. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Protease, Transcription Factors |
Citations (2)
The use of this Proteins has been cited in the following citations: |
---|
Berberine diminishes cancer cell PD-L1 expression and facilitates antitumor immunity via inhibiting the deubiquitination activity of CSN5
,null,
Acta Pharmaceutica Sinica. B
,PubMed ID 33354502
[COPS5]
|
Berberine diminishes cancer cell PD-L1 expression and facilitates antitumor immunity via inhibiting the deubiquitination activity of CSN5
,Liu, Y;Liu, X;Zhang, N;Yin, M;Dong, J;Zeng, Q;Mao, G;Song, D;Liu, L;Deng, H;,
Acta Pharmaceutica Sinica B
[COPS5]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416392 | COPS5 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY416392 | Transient overexpression lysate of COP9 constitutive photomorphogenic homolog subunit 5 (Arabidopsis) (COPS5) |
CN¥ 3,080.00 |
|
PH300979 | COPS5 MS Standard C13 and N15-labeled recombinant protein (NP_006828) |
CN¥ 19,520.00 |