TMEM51 (NM_018022) Human Recombinant Protein
CAT#: TP300965
Recombinant protein of human transmembrane protein 51 (TMEM51), transcript variant 4, 20 µg
View other "TMEM51" proteins (13)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200965 protein sequence
Red=Cloning site Green=Tags(s) MMAQSKANGSHYALTAIGLGMLVLGVIMAMWNLVPGFSAAEKPTAQGSNKTEVGGGILKSKTFSVAYVLV GAGVMLLLLSICLSIRDKRKQRQGEDLAHVQHPTGAGPHAQEEDSQEEEEEDEEAASRYYVPSYEEVMNT NYSEARGEEQNPRLSISLPSYESLTGLDETTPTSTRADVEASPGNPPDRQNSKLAKRLKPLKVRRIKSEK LHLKDFRINLPDKNVPPPSIEPLTPPPQYDEVQEKAPDTRPPD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 27.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_060492 |
Locus ID | 55092 |
UniProt ID | Q9NW97, A0A024QZ97 |
Refseq Size | 1927 |
Cytogenetics | 1p36.21 |
Refseq ORF | 759 |
Synonyms | C1orf72 |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413385 | TMEM51 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427856 | TMEM51 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427857 | TMEM51 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427858 | TMEM51 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413385 | Transient overexpression lysate of transmembrane protein 51 (TMEM51), transcript variant 4 |
CNY 3,080.00 |
|
LY427856 | Transient overexpression lysate of transmembrane protein 51 (TMEM51), transcript variant 1 |
CNY 3,080.00 |
|
LY427857 | Transient overexpression lysate of transmembrane protein 51 (TMEM51), transcript variant 2 |
CNY 3,080.00 |
|
LY427858 | Transient overexpression lysate of transmembrane protein 51 (TMEM51), transcript variant 3 |
CNY 3,080.00 |
|
PH300965 | TMEM51 MS Standard C13 and N15-labeled recombinant protein (NP_060492) |
CNY 19,520.00 |
|
PH326828 | TMEM51 MS Standard C13 and N15-labeled recombinant protein (NP_001129689) |
CNY 14,250.00 |
|
PH326856 | TMEM51 MS Standard C13 and N15-labeled recombinant protein (NP_001129690) |
CNY 14,250.00 |
|
TP326828 | Purified recombinant protein of Homo sapiens transmembrane protein 51 (TMEM51), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP326856 | Purified recombinant protein of Homo sapiens transmembrane protein 51 (TMEM51), transcript variant 3, 20 µg |
CNY 2,900.00 |