TMEM51 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TMEM51 antibody: synthetic peptide directed towards the N terminal of human TMEM51. Synthetic peptide located within the following region: GFSAAEKPTAQGSNKTEVGGGILKSKTFSVAYVLVGAGVMLLLLSICLSI
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	28 kDa
Gene Name	transmembrane protein 51
Database Link	NP_060492 Entrez Gene 55092 Human UniProt ID Q9NW97
Background	TMEM51 is a multi-pass membrane protein. The function of the TMEM51 protein remains unknown.
Synonyms	C1orf72
Note	Immunogen Sequence Homology: Human: 100%; Horse: 93%; Pig: 92%; Rat: 92%; Guinea pig: 92%; Dog: 86%; Bovine: 85%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.