GRHPR (NM_012203) Human Recombinant Protein
CAT#: TP300963M
Recombinant protein of human glyoxylate reductase/hydroxypyruvate reductase (GRHPR), 100 µg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 9,998.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200963 protein sequence
Red=Cloning site Green=Tags(s) MRPVRLMKVFVTRRIPAEGRVALARAADCEVEQWDSDEPIPAKELERGVAGAHGLLCLLSDHVDKRILDA AGANLKVISTMSVGIDHLALDEIKKRGIRVGYTPDVLTDTTAELAVSLLLTTCRRLPEAIEEVKNGGWTS WKPLWLCGYGLTQSTVGIIGLGRIGQAIARRLKPFGVQRFLYTGRQPRPEEAAEFQAEFVSTPELAAQSD FIVVACSLTPATEGLCNKDFFQKMKETAVFINISRGDVVNQDDLYQALASGKIAAAGLDVTSPEPLPTNH PLLTLKNCVILPHIGSATHRTRNTMSLLAANNLLAGLRGEPMPSELKL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 35.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_036335 |
Locus ID | 9380 |
UniProt ID | Q9UBQ7 |
Refseq Size | 1235 |
Cytogenetics | 9p13.2 |
Refseq ORF | 984 |
Synonyms | GLXR; GLYD; PH2 |
Summary | This gene encodes an enzyme with hydroxypyruvate reductase, glyoxylate reductase, and D-glycerate dehydrogenase enzymatic activities. The enzyme has widespread tissue expression and has a role in metabolism. Type II hyperoxaluria is caused by mutations in this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Glyoxylate and dicarboxylate metabolism, Metabolic pathways, Pyruvate metabolism |
Documents
FAQs |
SDS |