PLPBP (NM_007198) Human Recombinant Protein
CAT#: TP300853
Recombinant protein of human proline synthetase co-transcribed homolog (bacterial) (PROSC), 20 µg
View other "PLPBP" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200853 protein sequence
Red=Cloning site Green=Tags(s) MWRAGSMSAELGVGCALRAVNERVQQAVARRPRDLPAIQPRLVAVSKTKPADMVIEAYGHGQRTFGENYV QELLEKASNPKILSLCPEIKWHFIGHLQKQNVNKLMAVPNLFMLETVDSVKLADKVNSSWQRKGSPERLK VMVQINTSGEESKHGLPPSETIAIVEHINAKCPNLEFVGLMTIGSFGHDLSQGPNPDFQLLLSLREELCK KLNIPADQVELSMGMSADFQHAVEVGSTNVRIGSTIFGERDYSKKPTPDKCAADVKAPLEVAQEH myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 30.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_009129 |
Locus ID | 11212 |
UniProt ID | O94903 |
Refseq Size | 2586 |
Cytogenetics | 8p11.23 |
Refseq ORF | 825 |
Synonyms | EPVB6D; PROSC |
Summary | This gene encodes a pyridoxal 5'-phosphate binding protein involved in the homeostatic regulation of intracellular pyridoxal 5'-phosphate. This gene has a tumor suppressive effect on hepatocellular carcinoma and other solid tumors of epithelial origin. Naturally occurring mutations in this gene are associated with a pyridoxine-dependent epilepsy. [provided by RefSeq, Mar 2017] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416132 | PROSC HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY416132 | Transient overexpression lysate of proline synthetase co-transcribed homolog (bacterial) (PROSC) |
CN¥ 3,080.00 |
|
PH300853 | PROSC MS Standard C13 and N15-labeled recombinant protein (NP_009129) |
CN¥ 19,520.00 |