MTMR14 (NM_022485) Human Recombinant Protein
CAT#: TP300809
Recombinant protein of human myotubularin related protein 14 (MTMR14), transcript variant 3, 20 µg
View other "MTMR14" proteins (11)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 2 publications. |
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200809 protein sequence
Red=Cloning site Green=Tags(s) MAGARAAAAAASAGSSASSGNQPPQELGLGELLEEFSRTQYRAKDGSGTGGSKVERIEKRCLELFGRDYC FSVIPNTNGDICGHYPRHIVFLEYESSEKEKDTFESTVQVSKLQDLIHRSKMARCRGRFVCPVILFKGKH ICRSATLAGWGELYGRSGYNYFFSGGADDAWADVEDVTEEDCALRSGDTHLFDKVRGYDIKLLRYLSVKY ICDLMVENKKVKFGMNVTSSEKVDKAQRYADFTLLSIPYPGCEFFKEYKDRDYMAEGLIFNWKQDYVDAP LSIPDFLTHSLNIDWSQYQCWDLVQQTQNYLKLLLSLVNSDDDSGLLVHCISGWDRTPLFISLLRLSLWA DGLIHTSLKPTEILYLTVAYDWFLFGHMLVDRLSKGEEIFFFCFNFLKHITSEEFSALKTQRRKSLPARD GGFTLEDICMLRRKDRGSTTSLGSDFSLVMESSPGATGSFTYEAVELVPAGAPTQAAWLAALSDRETRLQ EVRSAFLAAYSSTVGLRAVAPSPSGAIGGLLEQFARGVGLRSISSNAL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 59.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | Enzyme activity (PMID: 26312549) Enzyme activity (PMID: 28205624) |
Reference Data | |
RefSeq | NP_071930 |
Locus ID | 64419 |
UniProt ID | Q8NCE2 |
Refseq Size | 2200 |
Cytogenetics | 3p25.3 |
Refseq ORF | 1614 |
Synonyms | C3orf29 |
Summary | This gene encodes a myotubularin-related protein. The encoded protein is a phosphoinositide phosphatase that specifically dephosphorylates phosphatidylinositol 3,5-biphosphate and phosphatidylinositol 3-phosphate. Mutations in this gene are correlated with autosomal dominant centronuclear myopathy. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 18.[provided by RefSeq, Apr 2010] |
Protein Families | Druggable Genome, Phosphatase, Secreted Protein |
Citations (2)
The use of this Proteins has been cited in the following citations: |
---|
The small molecule AUTEN-99 (autophagy enhancer-99) prevents the progression of neurodegenerative symptoms
,Kovács, T;Billes, V;Komlós, M;Hotzi, B;Manzéger, A;Tarnóci, A;Papp, D;Szikszai, F;Szinyákovics, J;Rácz, Á;Noszál, B;Veszelka, S;Walter, FR;Deli, MA;Hackler, L;Alfoldi, R;Huzian, O;Puskas, LG;Liliom, H;Tárnok, K;Schlett, K;Borsy, A;Welker, E;Kovács, AL;Pádár, Z;Erdős, A;Legradi, A;Bjelik, A;Gulya, K;Gulyás, B;Vellai, T;,
Sci Rep
,PubMed ID 28205624
[MTMR14]
|
AUTEN-67, an autophagy-enhancing drug candidate with potent antiaging and neuroprotective effects
,Papp, D;Kovács, T;Billes, V;Varga, M;Tarnóci, A;Hackler, L;Puskás, LG;Liliom, H;Tárnok, K;Schlett, K;Borsy, A;Pádár, Z;Kovács, AL;Hegedus, K;Juhász, G;Komlós, M;Erdos, A;Gulyás, B;Vellai, T;,
Autophagy
,PubMed ID 26312549
[MTMR14]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411652 | MTMR14 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421457 | MTMR14 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421458 | MTMR14 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411652 | Transient overexpression lysate of myotubularin related protein 14 (MTMR14), transcript variant 3 |
CNY 3,080.00 |
|
LY421457 | Transient overexpression lysate of myotubularin related protein 14 (MTMR14), transcript variant 2 |
CNY 3,080.00 |
|
LY421458 | Transient overexpression lysate of myotubularin related protein 14 (MTMR14), transcript variant 1 |
CNY 3,080.00 |
|
PH300809 | MTMR14 MS Standard C13 and N15-labeled recombinant protein (NP_071930) |
CNY 19,520.00 |
|
PH307732 | MTMR14 MS Standard C13 and N15-labeled recombinant protein (NP_001070993) |
CNY 19,520.00 |
|
PH308660 | MTMR14 MS Standard C13 and N15-labeled recombinant protein (NP_001070994) |
CNY 19,520.00 |
|
TP307732 | Recombinant protein of human myotubularin related protein 14 (MTMR14), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP308660 | Recombinant protein of human myotubularin related protein 14 (MTMR14), transcript variant 1, 20 µg |
CNY 2,900.00 |