C3orf10 (BRK1) (NM_018462) Human Recombinant Protein
CAT#: TP300804
Recombinant protein of human chromosome 3 open reading frame 10 (C3orf10), 20 µg
View other "C3orf10" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200804 protein sequence
Red=Cloning site Green=Tags(s) MAGQEDPVQREIHQDWANREYIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTK GETLT myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 8.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_060932 |
Locus ID | 55845 |
UniProt ID | Q8WUW1 |
Refseq Size | 1197 |
Cytogenetics | 3p25.3 |
Refseq ORF | 225 |
Synonyms | C3orf10; hHBrk1; HSPC300; MDS027 |
Summary | Involved in regulation of actin and microtubule organization. Part of a WAVE complex that activates the Arp2/3 complex. As component of the WAVE1 complex, required for BDNF-NTRK2 endocytic trafficking and signaling from early endosomes (By similarity).[UniProtKB/Swiss-Prot Function] |
Protein Pathways | Regulation of actin cytoskeleton |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413040 | BRK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413040 | Transient overexpression lysate of chromosome 3 open reading frame 10 (C3orf10) |
CNY 3,080.00 |
|
PH300804 | C3orf10 MS Standard C13 and N15-labeled recombinant protein (NP_060932) |
CNY 19,520.00 |
其它C3orf10产品