SOX2 (NM_003106) Human Recombinant Protein
CAT#: TP300757
Recombinant protein of human SRY (sex determining region Y)-box 2 (SOX2), 20 µg
View other "SOX2" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200757 protein sequence
Red=Cloning site Green=Tags(s) MYNMMETELKPPGPQQTSGGGGGNSTAAAAGGNQKNSPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSE ISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLMKKDKYTLPGGLLAPGGNSMA SGVGVGAGLGAGVNQRMDSYAHMNGWSNGSYSMMQDQLGYPQHPGLNAHGAAQMQPMHRYDVSALQYNSM TSSQTYMNGSPTYSMSYSQQGTPGMALGSMGSVVKSEASSSPPVVTSSSHSRAPCQAGDLRDMISMYLPG AEVPEPAAPSRLHMSQHYQSGPVPGTAINGTLPLSHM myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 34.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | EMSA assay (PMID: 25892221) |
Reference Data | |
RefSeq | NP_003097 |
Locus ID | 6657 |
UniProt ID | P48431, A0A0U3FYV6 |
Refseq Size | 2520 |
Cytogenetics | 3q26.33 |
Refseq ORF | 951 |
Synonyms | ANOP3; MCOPS3 |
Summary | This intronless gene encodes a member of the SRY-related HMG-box (SOX) family of transcription factors involved in the regulation of embryonic development and in the determination of cell fate. The product of this gene is required for stem-cell maintenance in the central nervous system, and also regulates gene expression in the stomach. Mutations in this gene have been associated with optic nerve hypoplasia and with syndromic microphthalmia, a severe form of structural eye malformation. This gene lies within an intron of another gene called SOX2 overlapping transcript (SOX2OT). [provided by RefSeq, Jul 2008] |
Protein Families | Adult stem cells, Cancer stem cells, Embryonic stem cells, ES Cell Differentiation/IPS, Induced pluripotent stem cells, Transcription Factors |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Pioneer transcription factors target partial DNA motifs on nucleosomes to initiate reprogramming
,Soufi, A;Garcia, MF;Jaroszewicz, A;Osman, N;Pellegrini, M;Zaret, KS;,
Cell
,PubMed ID 25892221
[SOX2]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401083 | SOX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401083 | Transient overexpression lysate of SRY (sex determining region Y)-box 2 (SOX2) |
CNY 3,080.00 |
|
PH300757 | SOX2 MS Standard C13 and N15-labeled recombinant protein (NP_003097) |
CNY 19,520.00 |