beta III Tubulin (TUBB3) (NM_006086) Human Recombinant Protein
CAT#: TP300755
Recombinant protein of human tubulin, beta 3 (TUBB3), 20 µg
View other "beta III Tubulin" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 3 publications. |
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200755 protein sequence
Red=Cloning site Green=Tags(s) MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPSGNYVGDSDLQLERISVYYNEASSHKYVPRAILVDLEP GTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLG GGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDI CFRTLKLATPTYGDLNHLVSATMSGVTTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTARGSQQ YRALTVPELTQQMFDAKNMMAACDPRHGRYLTVATVFRGRMSMKEVDEQMLAIQSKNSSYFVEWIPNNVK VAVCDIPPRGLKMSSTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS EYQQYQDATAEEEGEMYEDDEEESEAQGPK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 50.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | Co-immunoprecipitation (PMID: 25754961) |
Reference Data | |
RefSeq | NP_006077 |
Locus ID | 10381 |
UniProt ID | Q13509 |
Refseq Size | 1794 |
Cytogenetics | 16q24.3 |
Refseq ORF | 1350 |
Synonyms | beta-4; CDCBM; CDCBM1; CFEOM3; CFEOM3A; FEOM3; TUBB4 |
Summary | This gene encodes a class III member of the beta tubulin protein family. Beta tubulins are one of two core protein families (alpha and beta tubulins) that heterodimerize and assemble to form microtubules. This protein is primarily expressed in neurons and may be involved in neurogenesis and axon guidance and maintenance. Mutations in this gene are the cause of congenital fibrosis of the extraocular muscles type 3. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 6. [provided by RefSeq, Oct 2010] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS |
Protein Pathways | Gap junction, Pathogenic Escherichia coli infection |
Citations (3)
The use of this Proteins has been cited in the following citations: |
---|
Coordinated interaction of Down syndrome cell adhesion molecule and deleted in colorectal cancer with dynamic TUBB3 mediates Netrin-1-induced axon branching
,Huang, H;Shao, Q;Qu, C;Yang, T;Dwyer, T;Liu, G;,
Neuroscience
,PubMed ID 25754961
[TUBB3]
|
Direct binding of TUBB3 with DCC couples netrin-1 signaling to intracellular microtubule dynamics in axon outgrowth and guidance
,Chao Qu, Trisha Dwyer, Qiangqiang Shao, Tao Yang, Huai Huang, and Guofa Liu,
J. Cell Sci., Jul 2013; 126: 3070 - 3081.
,PubMed ID 23641072
[TUBB3]
|
The Coordination of Netrin Signal Transduction via TUBB3 and JNK1 in Axon
,Qu, C;,
Thesis Jul 2013
[TUBB3]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
其它beta III Tubulin产品