HERPUD1 (NM_001010989) Human Recombinant Protein
CAT#: TP300693
Recombinant protein of human homocysteine-inducible, endoplasmic reticulum stress-inducible, ubiquitin-like domain member 1 (HERPUD1), transcript variant 2, 20 µg
View other "HERPUD1" proteins (11)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200693 representing NM_001010989
Red=Cloning site Green=Tags(s) MESETEPEPVTLLVKSPNQRHRDLELSGDRGWSVGHLKAHLSRVYPERPRPEDQRLIYSGKLLLDHQCLR DLLPKQEKRHVLHLVCNVKSPSKMPEINAKVAESTEEPAGSNRGQYPEDSSSDGLRQREVLRNLSSPGWE NISRPEAAQQAFQGLGPGFSGYTPYGWLQLSWFQQIYARQYYMQYLAATAASGAFVPPPSAQEIPVVSAP APAPIHNQFPAENQPANQNAAPQVVVNPGANQNLRMNAQGGPIVEEDDEINRDWLDWTYSAATFSVFLSI LYFYSSLSRFLMVMGATVVMYLHHVGWFPFRPRPVQNFPNDGPPPDVVNQDPNNNLQEGTDPETEDPNHL PPDRDVLDGEQTSPSFMSTAWLVFKTFFASLLPEGPPAIAN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 43.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001010989 |
Locus ID | 9709 |
UniProt ID | Q15011 |
Refseq Size | 2195 |
Cytogenetics | 16q13 |
Refseq ORF | 1173 |
Synonyms | HERP; Mif1; SUP |
Summary | The accumulation of unfolded proteins in the endoplasmic reticulum (ER) triggers the ER stress response. This response includes the inhibition of translation to prevent further accumulation of unfolded proteins, the increased expression of proteins involved in polypeptide folding, known as the unfolded protein response (UPR), and the destruction of misfolded proteins by the ER-associated protein degradation (ERAD) system. This gene may play a role in both UPR and ERAD. Its expression is induced by UPR and it has an ER stress response element in its promoter region while the encoded protein has an N-terminal ubiquitin-like domain which may interact with the ERAD system. This protein has been shown to interact with presenilin proteins and to increase the level of amyloid-beta protein following its overexpression. Alternative splicing of this gene produces multiple transcript variants encoding different isoforms. The full-length nature of all transcript variants has not been determined. [provided by RefSeq, Jan 2013] |
Protein Families | Druggable Genome |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
HERPUD1 protects against oxidative stress-induced apoptosis through downregulation of the inositol 1,4,5-trisphosphate receptor
,null,
Free radical biology & medicine
,PubMed ID 26616647
[HERPUD1]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402364 | HERPUD1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423260 | HERPUD1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423261 | HERPUD1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402364 | Transient overexpression lysate of homocysteine-inducible, endoplasmic reticulum stress-inducible, ubiquitin-like domain member 1 (HERPUD1), transcript variant 1 |
CNY 3,080.00 |
|
LY423260 | Transient overexpression lysate of homocysteine-inducible, endoplasmic reticulum stress-inducible, ubiquitin-like domain member 1 (HERPUD1), transcript variant 2 |
CNY 3,080.00 |
|
LY423261 | Transient overexpression lysate of homocysteine-inducible, endoplasmic reticulum stress-inducible, ubiquitin-like domain member 1 (HERPUD1), transcript variant 3 |
CNY 3,080.00 |
|
PH300693 | HERPUD1 MS Standard C13 and N15-labeled recombinant protein (NP_001010989) |
CNY 19,520.00 |
|
PH311835 | HERPUD1 MS Standard C13 and N15-labeled recombinant protein (NP_055500) |
CNY 14,250.00 |
|
PH317811 | HERPUD1 MS Standard C13 and N15-labeled recombinant protein (NP_001010990) |
CNY 14,250.00 |
|
TP311835 | Recombinant protein of human homocysteine-inducible, endoplasmic reticulum stress-inducible, ubiquitin-like domain member 1 (HERPUD1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP317811 | Purified recombinant protein of Homo sapiens homocysteine-inducible, endoplasmic reticulum stress-inducible, ubiquitin-like domain member 1 (HERPUD1), transcript variant 3, 20 µg |
CNY 2,900.00 |
其它HERPUD1产品