PFDN1 (NM_002622) Human Recombinant Protein
CAT#: TP300584
Recombinant protein of human prefoldin subunit 1 (PFDN1), 20 µg
View other "PFDN1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200584 protein sequence
Red=Cloning site Green=Tags(s) MAAPVDLELKKAFTELQAKVIDTQQKVKLADIQIEQLNRTKKHAHLTDTEIMTLVDETNMYEGVGRMFIL QSKEAIHSQLLEKQKIAEEKIKELEQKKSYLERSVKEAEDNIREMLMARRAQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 14 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002613 |
Locus ID | 5201 |
UniProt ID | O60925 |
Refseq Size | 1324 |
Cytogenetics | 5q31.3 |
Refseq ORF | 366 |
Synonyms | PDF; PFD1 |
Summary | This gene encodes a member of the prefoldin beta subunit family. The encoded protein is one of six subunits of prefoldin, a molecular chaperone complex that binds and stabilizes newly synthesized polypeptides, thereby allowing them to fold correctly. The complex, consisting of two alpha and four beta subunits, forms a double beta barrel assembly with six protruding coiled-coils. [provided by RefSeq, Jul 2008] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419197 | PFDN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419197 | Transient overexpression lysate of prefoldin subunit 1 (PFDN1) |
CNY 3,080.00 |
|
PH300584 | PFDN1 MS Standard C13 and N15-labeled recombinant protein (NP_002613) |
CNY 19,520.00 |