PFDN1 (NM_002622) Human Mass Spec Standard
CAT#: PH300584
PFDN1 MS Standard C13 and N15-labeled recombinant protein (NP_002613)
View other "PFDN1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | PFDN1 MS Standard C13 and N15-labeled recombinant protein (NP_002613) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200584 |
Predicted MW | 14.2 kDa |
Protein Sequence |
>RC200584 protein sequence
Red=Cloning site Green=Tags(s) MAAPVDLELKKAFTELQAKVIDTQQKVKLADIQIEQLNRTKKHAHLTDTEIMTLVDETNMYEGVGRMFIL QSKEAIHSQLLEKQKIAEEKIKELEQKKSYLERSVKEAEDNIREMLMARRAQ myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002613 |
RefSeq Size | 1324 |
RefSeq ORF | 366 |
Synonyms | PDF; PFD1 |
Locus ID | 5201 |
Cytogenetics | 5q31.3 |
Summary | This gene encodes a member of the prefoldin beta subunit family. The encoded protein is one of six subunits of prefoldin, a molecular chaperone complex that binds and stabilizes newly synthesized polypeptides, thereby allowing them to fold correctly. The complex, consisting of two alpha and four beta subunits, forms a double beta barrel assembly with six protruding coiled-coils. [provided by RefSeq, Jul 2008] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419197 | PFDN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419197 | Transient overexpression lysate of prefoldin subunit 1 (PFDN1) |
CNY 3,080.00 |
|
TP300584 | Recombinant protein of human prefoldin subunit 1 (PFDN1), 20 µg |
CNY 2,900.00 |