PSMG1 (NM_003720) Human Recombinant Protein
CAT#: TP300550
Recombinant protein of human proteasome (prosome, macropain) assembly chaperone 1 (PSMG1), transcript variant 1, 20 µg
View other "PSMG1" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200550 protein sequence
Red=Cloning site Green=Tags(s) MAATFFGEVVKAPCRAGTEDEEEEEEGRRETPEDREVRLQLARKREVRLLRRQTKTSLEVSLLEKYPCSK FIIAIGNNAVAFLSSFVMNSGVWEEVGCAKLWNEWCRTTDTTHLSSTEAFCVFYHLKSNPSVFLCQCSCY VAEDQQYQWLEKVFGSCPRKNMQITILTCRHVTDYKTSESTGSLPSPFLRALKTQNFKDSACCPLLEQPN IVHDLPAAVLSYCQVWKIPAILYLCYTDVMKLDLITVEAFKPILSTRSLKGLVKNIPQSTEILKKLMTTN EIQSNIYT myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 32.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003711 |
Locus ID | 8624 |
UniProt ID | O95456 |
Refseq Size | 1140 |
Cytogenetics | 21q22.2 |
Refseq ORF | 864 |
Synonyms | C21LRP; DSCR2; LRPC21; PAC-1; PAC1 |
Summary | Chaperone protein which promotes assembly of the 20S proteasome as part of a heterodimer with PSMG2. The PSMG1-PSMG2 heterodimer binds to the PSMA5 and PSMA7 proteasome subunits, promotes assembly of the proteasome alpha subunits into the heteroheptameric alpha ring and prevents alpha ring dimerization.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401225 | PSMG1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC404289 | PSMG1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401225 | Transient overexpression lysate of proteasome (prosome, macropain) assembly chaperone 1 (PSMG1), transcript variant 1 |
CNY 3,080.00 |
|
LY404289 | Transient overexpression lysate of proteasome (prosome, macropain) assembly chaperone 1 (PSMG1), transcript variant 2 |
CNY 3,080.00 |
|
PH300550 | PSMG1 MS Standard C13 and N15-labeled recombinant protein (NP_003711) |
CNY 19,520.00 |