Stanniocalcin 2 (STC2) (NM_003714) Human Recombinant Protein
CAT#: TP300537
Recombinant protein of human stanniocalcin 2 (STC2), 20 µg
View other "Stanniocalcin 2" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200537 protein sequence
Red=Cloning site Green=Tags(s) MCAERLGQFMTLALVLATFDPARGTDATNPPEGPQDRSSQQKGRLSLQNTAEIQHCLVNAGDVGCGVFEC FENNSCEIRGLHGICMTFLHNAGKFDAQGKSFIKDALKCKAHALRHRFGCISRKCPAIREMVSQLQRECY LKHDLCAAAQENTRVIVEMIHFKDLLLHEPYVDLVNLLLTCGEEVKEAITHSVQVQCEQNWGSLCSILSF CTSAIQKPPTAPPERQPQVDRTKLSRAHHGEAGHHLPEPSSRETGRGAKGERGSKSHPNAHARGRVGGLG AQGPSGSSEWEDEQSEYSDIRR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 30.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003705 |
Locus ID | 8614 |
UniProt ID | O76061, Q6FHC9 |
Refseq Size | 5361 |
Cytogenetics | 5q35.2 |
Refseq ORF | 906 |
Synonyms | STC-2; STCRP |
Summary | This gene encodes a secreted, homodimeric glycoprotein that is expressed in a wide variety of tissues and may have autocrine or paracrine functions. The encoded protein has 10 of its 15 cysteine residues conserved among stanniocalcin family members and is phosphorylated by casein kinase 2 exclusively on its serine residues. Its C-terminus contains a cluster of histidine residues which may interact with metal ions. The protein may play a role in the regulation of renal and intestinal calcium and phosphate transport, cell metabolism, or cellular calcium/phosphate homeostasis. Constitutive overexpression of human stanniocalcin 2 in mice resulted in pre- and postnatal growth restriction, reduced bone and skeletal muscle growth, and organomegaly. Expression of this gene is induced by estrogen and altered in some breast cancers. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401224 | STC2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401224 | Transient overexpression lysate of stanniocalcin 2 (STC2) |
CNY 3,080.00 |
|
PH300537 | STC2 MS Standard C13 and N15-labeled recombinant protein (NP_003705) |
CNY 19,520.00 |
|
TP700001 | Recombinant protein of mature form of human stanniocalcin 2 (STC2) with C-terminal DDK/His tag, expressed in human cells |
CNY 6,650.00 |
其它Stanniocalcin 2产品