Stanniocalcin 2 (STC2) (NM_003714) Human Mass Spec Standard
CAT#: PH300537
STC2 MS Standard C13 and N15-labeled recombinant protein (NP_003705)
View other "Stanniocalcin 2" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | STC2 MS Standard C13 and N15-labeled recombinant protein (NP_003705) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200537 |
Predicted MW | 33.2 kDa |
Protein Sequence |
>RC200537 protein sequence
Red=Cloning site Green=Tags(s) MCAERLGQFMTLALVLATFDPARGTDATNPPEGPQDRSSQQKGRLSLQNTAEIQHCLVNAGDVGCGVFEC FENNSCEIRGLHGICMTFLHNAGKFDAQGKSFIKDALKCKAHALRHRFGCISRKCPAIREMVSQLQRECY LKHDLCAAAQENTRVIVEMIHFKDLLLHEPYVDLVNLLLTCGEEVKEAITHSVQVQCEQNWGSLCSILSF CTSAIQKPPTAPPERQPQVDRTKLSRAHHGEAGHHLPEPSSRETGRGAKGERGSKSHPNAHARGRVGGLG AQGPSGSSEWEDEQSEYSDIRR myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003705 |
RefSeq Size | 5361 |
RefSeq ORF | 906 |
Synonyms | STC-2; STCRP |
Locus ID | 8614 |
Cytogenetics | 5q35.2 |
Summary | This gene encodes a secreted, homodimeric glycoprotein that is expressed in a wide variety of tissues and may have autocrine or paracrine functions. The encoded protein has 10 of its 15 cysteine residues conserved among stanniocalcin family members and is phosphorylated by casein kinase 2 exclusively on its serine residues. Its C-terminus contains a cluster of histidine residues which may interact with metal ions. The protein may play a role in the regulation of renal and intestinal calcium and phosphate transport, cell metabolism, or cellular calcium/phosphate homeostasis. Constitutive overexpression of human stanniocalcin 2 in mice resulted in pre- and postnatal growth restriction, reduced bone and skeletal muscle growth, and organomegaly. Expression of this gene is induced by estrogen and altered in some breast cancers. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401224 | STC2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401224 | Transient overexpression lysate of stanniocalcin 2 (STC2) |
CNY 3,080.00 |
|
TP300537 | Recombinant protein of human stanniocalcin 2 (STC2), 20 µg |
CNY 2,900.00 |
|
TP700001 | Recombinant protein of mature form of human stanniocalcin 2 (STC2) with C-terminal DDK/His tag, expressed in human cells |
CNY 6,650.00 |
其它Stanniocalcin 2产品