CRMP1 (NM_001313) Human Recombinant Protein
CAT#: TP300483
Recombinant protein of human collapsin response mediator protein 1 (CRMP1), transcript variant 2, 20 µg
View other "CRMP1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200483 protein sequence
Red=Cloning site Green=Tags(s) MSYQGKKSIPHITSDRLLIKGGRIINDDQSLYADVYLEDGLIKQIGENLIVPGGVKTIEANGRMVIPGGI DVNTYLQKPSQGMTAADDFFQGTRAALVGGTTMIIDHVVPEPGSSLLTSFEKWHEAADTKSCCDYSLHVD ITSWYDGVREELEVLVQDKGVNSFQVYMAYKDVYQMSDSQLYEAFTFLKGLGAVILVHAENGDLIAQEQK RILEMGITGPEGHALSRPEELEAEAVFRAITIAGRINCPVYITKVMSKSAADIIALARKKGPLVFGEPIA ASLGTDGTHYWSKNWAKAAAFVTSPPLSPDPTTPDYLTSLLACGDLQVTGSGHCPYSTAQKAVGKDNFTL IPEGVNGIEERMTVVWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDADVVIWDPDKLKTI TAKSHKSAVEYNIFEGMECHGSPLVVISQGKIVFEDGNINVNKGMGRFIPRKAFPEHLYQRVKIRNKVFG LQGVSRGMYDGPVYEVPATPKYATPAPSAKSSPSKHQPPPIRNLHQSNFSLSGAQIDDNNPRRTGHRIVA PPGGRSNITSLG myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 62 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001304 |
Locus ID | 1400 |
UniProt ID | Q14194 |
Refseq Size | 3074 |
Cytogenetics | 4p16.2 |
Refseq ORF | 1716 |
Synonyms | CRMP-1; DPYSL1; DRP-1; DRP1; ULIP-3 |
Summary | This gene encodes a member of a family of cytosolic phosphoproteins expressed exclusively in the nervous system. The encoded protein is thought to be a part of the semaphorin signal transduction pathway implicated in semaphorin-induced growth cone collapse during neural development. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2008] |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Autism-specific maternal autoantibodies recognize critical proteins in developing brain
,D Braunschweig, P Krakowiak, P Duncanson, R Boyce, R L Hansen, + et al.,
Translational Psychiatry 3, e277 doi:10.1038/tp.2013.50
,PubMed ID 23838888
[CRMP1]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400522 | CRMP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400522 | Transient overexpression lysate of collapsin response mediator protein 1 (CRMP1), transcript variant 2 |
CNY 3,080.00 |
|
PH300483 | CRMP1 MS Standard C13 and N15-labeled recombinant protein (NP_001304) |
CNY 19,520.00 |