GALK1 (NM_000154) Human Recombinant Protein
CAT#: TP300476
Recombinant protein of human galactokinase 1 (GALK1), 20 µg
View other "GALK1" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200476 protein sequence
Red=Cloning site Green=Tags(s) MAALRQPQVAELLAEARRAFREEFGAEPELAVSAPGRVNLIGEHTDYNQGLVLPMALELMTVLVGSPRKD GLVSLLTTSEGADEPQRLQFPLPTAQRSLEPGTPRWANYVKGVIQYYPAAPLPGFSAVVVSSVPLGGGLS SSASLEVATYTFLQQLCPDSGTIAARAQVCQQAEHSFAGMPCGIMDQFISLMGQKGHALLIDCRSLETSL VPLSDPKLAVLITNSNVRHSLASSEYPVRRRQCEEVARALGKESLREVQLEELEAARDLVSKEGFRRARH VVGEIRRTAQAAAALRRGDYRAFGRLMVESHRSLRDDYEVSCPELDQLVEAALAVPGVYGSRMTGGGFGG CTVTLLEASAAPHAMRHIQEHYGGTATFYLSQAADGAKVLCL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 42.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_000145 |
Locus ID | 2584 |
UniProt ID | P51570 |
Refseq Size | 1361 |
Cytogenetics | 17q25.1 |
Refseq ORF | 1176 |
Synonyms | GALK; GK1; HEL-S-19 |
Summary | Galactokinase is a major enzyme for the metabolism of galactose and its deficiency causes congenital cataracts during infancy and presenile cataracts in the adult population. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Amino sugar and nucleotide sugar metabolism, Galactose metabolism, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424894 | GALK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY424894 | Transient overexpression lysate of galactokinase 1 (GALK1) |
CNY 3,080.00 |
|
PH300476 | GALK1 MS Standard C13 and N15-labeled recombinant protein (NP_000145) |
CNY 19,520.00 |
|
TP720538 | Recombinant protein of human galactokinase 1 (GALK1) |
CNY 1,800.00 |